Property Summary

NCBI Gene PubMed Count 74
Grant Count 77
R01 Count 51
Funding $3,669,484.57
PubMed Score 94.49
PubTator Score 122.49

Knowledge Summary

Patent (38,196)

Expression

  Differential Expression (17)

Synonym

Accession P20827 D3DV86 Q5SR60 Q5SR61 Q6I9T9 Q8N578
Symbols B61
EFL1
ECKLG
EPLG1
LERK1
LERK-1
TNFAIP4

Gene

PDB

3CZU   3HEI   3MBW  

Gene RIF (39)

PMID Text
24969670 Findings show that EFNA1 expression is a useful marker for predicting a high risk of recurrence in hepatocellular carcinoma patients but not EPHA2.
24853748 EphA2-ephrinA1 trans-endocytosis is sensitive to the mechanical properties of a cell's microenvironment
24330498 Expression of EPHRIN-A1 tends to be associated with worse survival in head and neck cancer.
24175772 Results suggest that EFNA1 is involved in colorectal tumorigenesis, and rs12904 A>G polymorphism in the 3' UTR of EFNA1 is associated with CRC susceptibility in a Chinese population.
24040255 Ephrin-A1 is upregulated in tumor microenvironment and promotes angiogenesis through a coordinated cross-talk with PI3K/Akt-dependent eNOS activation.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
23661698 Findings suggest that the glycosylation on ephrin-A1 plays a critical role in the binding and activation of the EphA2 receptor.
23298804 present study showed a high expression of EphA2/ephrinA1 in adenoid cystic carcinoma. EphA2/ephrinA1 can serve as a novel therapy target for adenoid cystic carcinoma.
23258614 EFNA1 expression is a useful marker for predicting high risk of relapse and cancer-related death in patients who have undergone curative resection for CRC.
23065816 Increased expression of EFNA1 mRNA is associated with gastric cancer.
More...

AA Sequence

MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILY      1 - 70
LVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRC     71 - 140
LRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP         141 - 205
//

Text Mined References (75)

PMID Year Title
24969670 2014 Association between ephrin-A1 mRNA expression and poor prognosis after hepatectomy to treat hepatocellular carcinoma.
24853748 2014 Spatial organization of EphA2 at the cell-cell interface modulates trans-endocytosis of ephrinA1.
24330498 2013 Expression of EPHRIN-A1, SCINDERIN and MHC class I molecules in head and neck cancers and relationship with the prognostic value of intratumoral CD8+ T cells.
24175772 2013 rs12904 polymorphism in the 3'UTR of EFNA1 is associated with colorectal cancer susceptibility in a Chinese population.
24040255 2013 Ephrin-A1 is up-regulated by hypoxia in cancer cells and promotes angiogenesis of HUVECs through a coordinated cross-talk with eNOS.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23661698 2013 Biological and structural characterization of glycosylation on ephrin-A1, a preferred ligand for EphA2 receptor tyrosine kinase.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23298804 2013 EphA2/ephrinA1 mRNA expression and protein production in adenoid cystic carcinoma of salivary gland.
More...