Property Summary

NCBI Gene PubMed Count 586
Grant Count 143
R01 Count 74
Funding $13,450,944.26
PubMed Score 609.82
PubTator Score 894.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P20815 A4D289 B7Z5I7 Q53WY8 Q75MV0 Q9HB56
Symbols CP35
PCN3
CYPIIIA5
P450PCN3

Gene

PANTHER Protein Class (2)

Gene RIF (622)

PMID Text
26915847 The requirement for daily maintenance dose was higher in those with CYP3A5*1/*1 variants in both tacrolimus formulations in the Malaysian Renal Transplant patients. Furthermore, those with CYP3A5*3/*3 demonstrated significantly higher dose-adjusted within-patient variability trough levels with Advograf.
26773964 findings suggest that the presence of the CYP3A5*1 allele contributes to marked elevation of CYP3A activity associated with recovery of renal function after kidney transplantation
26654672 Early postpartum women possessed higher CYP3A activity based on plasma 4beta-hydroxycholesterol and had a large pharmacokinetic variability in amlodipine disposition.
26651976 We herein discuss all published data on the contribution of CYP3A5 and its polymorphisms to the metabolism of antipsychotics and antidepressants that are known to be metabolized by CYP3A enzymes, as well as of carbamazepine, an antiepileptic drug used as mood stabilizer
26635230 Although CYP3A5 polymorphism significantly influenced the tacrolimus dose required to achieve the target concentration, the impact of CYP3A5 polymorphism on biopsy-proven acute rejection was not observed in this study
26634478 Three months after liver transplantation, C/D was both affected by the CYP3A5 genotype of both the donors and the recipients.
26615671 a critical role of the CYP3A5 6986A>G and CYP3A4 -392A>G polymorphisms on the variation of Tac exposure during the early and the late post-transplant phase, respectively.
26521259 Both donor and recipient CYP3A5 genotype significantly influences tacrolimus once daily pharmacokinetics in stable liver transplant recipients, while CYP3A4*22 is not a suitable biomarker
26507668 CYP3A5 genetic polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26485092 Loss-of-function variants in CYP3A5 is associated with tacrolimus trough concentrations in African American kidney allograft recipients.
More...

AA Sequence

MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGK      1 - 70
MWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG     71 - 140
KLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKF    141 - 210
LKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQN    211 - 280
SKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAV    281 - 350
VQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS    351 - 420
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVL    421 - 490
KVDSRDGTLSGE                                                              491 - 502
//

Text Mined References (587)

PMID Year Title
26915847 Effects of CYP3A5 Genetic Polymorphism on the Pharmacokinetics of Tacrolimus in Renal Transplant Recipients.
26773964 2015 CYP3A5 polymorphism affects the increase in CYP3A activity after living kidney transplantation in patients with end stage renal disease.
26654672 2015 CYP3A activity based on plasma 4?-hydroxycholesterol during the early postpartum period has an effect on the plasma disposition of amlodipine.
26651976 2016 Influence of CYP3A5 polymorphism on the pharmacokinetics of psychiatric drugs.
26635230 2016 Impact of CYP3A5 polymorphism on trough concentrations and outcomes of tacrolimus minimization during the early period after kidney transplantation.
26634478 2015 Effect of CYP3A5 gene polymorphisms on tacrolimus concentration/dosage ratio in adult liver transplant patients.
26615671 2015 Influence of combined CYP3A4 and CYP3A5 single-nucleotide polymorphisms on tacrolimus exposure in kidney transplant recipients: a study according to the post-transplant phase.
26521259 2016 Population pharmacokinetics and pharmacogenetics of once daily tacrolimus formulation in stable liver transplant recipients.
26507668 2015 Interethnic differences of cytochrome P450 gene polymorphisms may influence outcome of taxane therapy in Roma and Hungarian populations.
26485092 2016 Genomewide Association Study of Tacrolimus Concentrations in African American Kidney Transplant Recipients Identifies Multiple CYP3A5 Alleles.
More...