Property Summary

NCBI Gene PubMed Count 273
Grant Count 575
R01 Count 336
Funding $95,144,694.73
PubMed Score 5025.35
PubTator Score 1809.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.290 0.000
pancreatic ductal adenocarcinoma liver m... -2.956 0.003
lung cancer -1.600 0.000
lung adenocarcinoma -1.200 0.000
non primary Sjogren syndrome sicca -1.200 0.032
lung carcinoma -4.100 0.000
ulcerative colitis -1.800 0.000
chronic rhinosinusitis -1.303 0.015
psoriasis -1.100 0.004

Synonym

Accession P20813 B4DWP3 Q2V565 Q9UK46
Symbols CPB6
EFVM
IIB1
P450
CYP2B
CYP2B7
CYP2B7P
CYPIIB6

Gene

PDB

3IBD   3QOA   3QU8   3UA5   4I91   4RQL   4RRT   4ZV8  

Gene RIF (279)

PMID Text
27015760 Report shift in substrate specificity with sequence element swaps between CYP2B6 and CYP2B11.
27010727 gene expression experiment revealed that CYP2B6, SPON1, and GSG1L can be activated concomitantly through a constitutive androstane receptor (CAR) activation pathway
26982502 Data suggest peripheral ligand-binding pocket and active site are located on opposite sides of the I-helix in CYP2B6; similar results were obtained for CYP2B4.
26681005 CYP2B6 516G>T SNP is prevalent in Aregntinian population.
26602960 Both Cyp2b6 CT/TT genotype of rs8192719 (c.1294 + 3C > T) and AG genotype of rs2279343 (c.785A > G) prolonged survival (p < 0.05).
26580670 the cytochrome P450 oxidoreductase g.6593A>G polymorphism significantly influences CYP2B6 activity
26544874 POR besides CYP2B6 can influence cyclophosphamide metabolism
26456622 Observation in Chinese patients with systemic lupus erythematosus indicated that the combination genetic marker of CYP2C19*2 and CYP2B6 -750 T > C genotypes was associated with 4-OH-CPA plasma concentration, short term efficacy and adverse reactions of cyclophosphamide.
26366873 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26319176 Functional importance of a peripheral pocket in mammalian cytochrome P450 2B enzymes.
More...

AA Sequence

MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHL      1 - 70
GPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKR     71 - 140
SVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLIS    141 - 210
SVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAH    211 - 280
SEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTE    281 - 350
AVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL    351 - 420
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLP    421 - 490
R//

Text Mined References (278)

PMID Year Title
27015760 2016 Ordered chimerogenesis applied to CYP2B P450 enzymes.
27010727 2016 Genome-Wide Pharmacogenomic Study on Methadone Maintenance Treatment Identifies SNP rs17180299 and Multiple Haplotypes on CYP2B6, SPON1, and GSG1L Associated with Plasma Concentrations of Methadone R- and S-enantiomers in Heroin-Dependent Patients.
26982502 2016 Coumarin Derivatives as Substrate Probes of Mammalian Cytochromes P450 2B4 and 2B6: Assessing the Importance of 7-Alkoxy Chain Length, Halogen Substitution, and Non-Active Site Mutations.
26681005 2015 Prevalence of CYP2B6 polymorphisms in Argentinians: the role of genetic testing.
26602960 2015 The prognostic values of CYP2B6 genetic polymorphisms and metastatic sites for advanced breast cancer patients treated with docetaxel and thiotepa.
26544874 2015 Cytochrome P450 Oxidoreductase Influences CYP2B6 Activity in Cyclophosphamide Bioactivation.
26456622 2016 Genetic markers in CYP2C19 and CYP2B6 for prediction of cyclophosphamide's 4-hydroxylation, efficacy and side effects in Chinese patients with systemic lupus erythematosus.
26366873 2015 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26319176 2015 Functional importance of a peripheral pocket in mammalian cytochrome P450 2B enzymes.
26126958 2015 Metabolism of (-)-cis- and (-)-trans-rose oxide by cytochrome P450 enzymes in human liver microsomes.
More...