Property Summary

NCBI Gene PubMed Count 94
Grant Count 132
R01 Count 62
Funding $20,984,284.87
PubMed Score 761.99
PubTator Score 226.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.263 0.006
malignant mesothelioma -1.200 0.000
esophageal adenocarcinoma -1.300 0.044
astrocytoma 1.400 0.025
glioblastoma 1.800 0.006
primary pancreatic ductal adenocarcinoma 1.415 0.021
lung cancer -1.700 0.000
lung adenocarcinoma -1.700 0.000
pancreatic cancer 1.100 0.009

Synonym

Accession P20810 B7Z468 G5E946 G5E9D3 O95360 Q05DE8 Q7Z4K0 Q96D08 Q9H1Z5
Symbols BS-17
PLACK

Gene

Gene RIF (43)

PMID Text
25683118 We describe PLACK syndrome, as a clinical entity of defective epidermal adhesion, caused by loss-of-function mutations in calpastatin.
25648699 Loss of CAST in angiogenic ECs facilitates mu-calpain-induced SOCS3 degradation, which amplifies pathological angiogenesis through interleukin-6/STAT3/VEGF-C axis.
24462690 Calpastatin binds with Cav1.2 amino acid motifs in a calcium dependent manner.
23951044 Calpastatin gene (CAST) is not associated with late onset sporadic Parkinson's disease in the Han Chinese population.
23707532 HER2 inhibited calpain-1 activity through upregulating calpastatin, an endogenous calpain inhibitor.
23449483 Linkage analysis and genetic association support involvement of CAST gene in the genetic susceptibility to keratoconus.
23140395 The results suggest that calpain-2 and calpastatin expression is important in pancreatic cancers, influencing disease progression
22572592 Calpastatin overexpression reduces calpain-mediated proteolysis and behavioral impairment after traumatic brain injury.
22288381 Mycoplasma hyorhinis membrane lipoproteins induce calpastatin upregulation in human cells
22206846 Neuronal overexpression of calpastatin modulates amyloid precursor protein processing in brains of transgenic beta-amyloid depositing mice.
More...

AA Sequence

MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQA      1 - 70
SDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPV     71 - 140
ESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLA    141 - 210
KKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRK    211 - 280
VEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGK    281 - 350
PLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPP    351 - 420
EPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKD    421 - 490
GKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDT    491 - 560
SQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKP    561 - 630
VKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTE    631 - 700
ETSKPKDD                                                                  701 - 708
//

Text Mined References (103)

PMID Year Title
25683118 2015 Loss-of-function mutations in CAST cause peeling skin, leukonychia, acral punctate keratoses, cheilitis, and knuckle pads.
25648699 2015 Calpastatin counteracts pathological angiogenesis by inhibiting suppressor of cytokine signaling 3 degradation in vascular endothelial cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24462690 2014 The Ca(2+)-dependent interaction of calpastatin domain L with the C-terminal tail of the Cav1.2 channel.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23951044 2013 Calpastatin gene (CAST) is not associated with late onset sporadic Parkinson's disease in the Han Chinese population.
23773963 2013 Calpastatin is upregulated in non-immune neuronal cells via toll-like receptor 2 (TLR2) pathways by lipid-containing agonists.
23707532 2013 HER2 regulates Brk/PTK6 stability via upregulating calpastatin, an inhibitor of calpain.
23684705 2013 Modulation by Syk of Bcl-2, calcium and the calpain-calpastatin proteolytic system in human breast cancer cells.
More...