Property Summary

NCBI Gene PubMed Count 96
PubMed Score 781.23
PubTator Score 226.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.400 2.5e-02
esophageal adenocarcinoma -1.300 4.4e-02
glioblastoma 1.800 6.4e-03
lung adenocarcinoma -1.700 3.9e-11
lung cancer -1.700 3.0e-04
malignant mesothelioma -1.200 8.4e-07
Multiple myeloma 1.163 3.3e-03
pancreatic cancer 1.100 8.8e-03
primary pancreatic ductal adenocarcinoma 1.415 2.1e-02

Gene RIF (45)

AA Sequence

MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQA      1 - 70
SDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPV     71 - 140
ESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLA    141 - 210
KKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRK    211 - 280
VEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGK    281 - 350
PLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPP    351 - 420
EPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKD    421 - 490
GKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDT    491 - 560
SQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKP    561 - 630
VKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTE    631 - 700
ETSKPKDD                                                                  701 - 708
//

Text Mined References (106)

PMID Year Title