Property Summary

NCBI Gene PubMed Count 139
PubMed Score 680.74
PubTator Score 543.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 3.300 2.3e-02
malignant mesothelioma 2.300 2.0e-07
osteosarcoma 2.123 3.9e-09
ulcerative colitis 3.700 4.8e-04

Gene RIF (121)

AA Sequence

MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDH      1 - 70
NLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRL     71 - 140
QLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL               141 - 199
//

Text Mined References (142)

PMID Year Title