Property Summary

NCBI Gene PubMed Count 134
Grant Count 224
R01 Count 131
Funding $23,168,446.33
PubMed Score 655.38
PubTator Score 543.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
osteosarcoma 2.123 0.000
interstitial cystitis 3.300 0.023
ulcerative colitis 3.700 0.000

Synonym

Accession P20809 B4DQV5 Q96EB4 IL-11
Symbols AGIF
IL-11

Gene

PDB

4MHL  

Gene RIF (116)

PMID Text
26876177 Proteolysis of the IL-11R represents a molecular switch that controls the IL-11 trans-signaling pathway which is the target in intestinal tumorigenesis, lung carcinomas, and asthma.
26655736 Results indicate that iterleukin-11 (IL11) is causal of Preeclampsia (PE) features in a mouse model and likely in women, and suggest potential of IL11 inhibition to rescue PE symptoms in women.
26551460 The highly specific IL-11 - S100P interaction occurring under physiologically relevant conditions should be taken into consideration upon development of the antineoplastics inhibiting IL-11 signaling.
26452137 The cross-talk between Th17 and interleukin 11 (IL-11+)CD4+ T cells may induce and amplify the autoimmune response in the early stage of multiple sclerosis (MS), and thus represent an attractive therapeutic target in this and other inflammatory diseases.
26276375 IL-11 has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses, hence reducing the mortality in sepsis patients accompanied with thrombocytopenia.
26209885 IL-11 expression in breast cancer correlates with poor disease outcome
26172388 Genetic variations of IL-11 may be associated with the risk of Hirschsprung disease and/or the mechanisms related to enteric nervous system development.
26026087 The results of the present study show that TRAMP cells modified with H6 and H11 ( Hyper-IL-6 and Hyper-IL-11 )induce prostate tumor regression and increase mouse survival by stimulating the immune system.
25929737 MTA2 overexpression enhances colony formation and tumor growth of gastric cancer cells, but not plays important role in cancer cell migration and metastasis. IL-11 is one of the downstream effectors of MTA2 in regulating gastric cancer cells growth
25895532 IL-11 is identified as a new Th17-promoting cytokine, because it induces a differentiation of naive CD4(+) T cells into Th17 cells, as well as expansion of Th17 memory cells.
More...

AA Sequence

MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDH      1 - 70
NLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRL     71 - 140
QLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL               141 - 199
//

Text Mined References (137)

PMID Year Title
26876177 2016 Proteolytic Cleavage Governs Interleukin-11 Trans-signaling.
26655736 2015 Interleukin-11 alters placentation and causes preeclampsia features in mice.
26551460 2015 High-affinity interaction between interleukin-11 and S100P protein.
26452137 2015 IL-11 in multiple sclerosis.
26276375 2015 Recombinant human interleukin-11 (IL-11) is a protective factor in severe sepsis with thrombocytopenia: A case-control study.
26209885 2015 Emerging roles for IL-11 signaling in cancer development and progression: Focus on breast cancer.
26172388 2015 Genetic variants of IL-11 associated with risk of Hirschsprung disease.
26026087 2015 Cellular Vaccines Modified with Hyper IL6 or Hyper IL11 Combined with Docetaxel in an Orthotopic Prostate Cancer Model.
25929737 2015 MTA2 enhances colony formation and tumor growth of gastric cancer cells through IL-11.
25895532 2015 IL-11 Induces Th17 Cell Responses in Patients with Early Relapsing-Remitting Multiple Sclerosis.
More...