Property Summary

NCBI Gene PubMed Count 67
Grant Count 22
R01 Count 17
Funding $2,370,088.44
PubMed Score 356.56
PubTator Score 185.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
Breast cancer 2.100 0.001

Gene RIF (20)

PMID Text
24647318 EDN2 expression in left internal mammary arteries depends on tissue harvesting technique.
24043815 Overexpression of Edn2 in the mouse retina causes an excess of tip cells and inhibits vascular growth. Overexpression of Edn2 in the brain and skin had no effect, but vascular development was inhibited in midgestation mouse embryos.
23518706 Endothelin 2 and endothelin receptor type B may be a regenerative pathway for central nervous system myelination and remyelination.
22921304 plasma levels of big ET-2, and big ET-3 are markedly increased in patients with end stage renal disease on hemodialysis
22865632 Studies revealed hypermethylation of EDN2 and EDN3 genes in human primary colon cancers and in a panel of human colon cancer cell lines. Epigenetic inactivation of ET-2 and ET-3 occurs frequently in both rat and human colon cancers.
22727793 In granulosa lutein cells from women with polycystic ovary syndrome, endothelin-2 mRNA was reduced as compared with normally ovulating women
22047647 although endothelin 2 does not appear to be an independent prognostic marker, there is evidence of a putative role in clear cell renal cell carcinoma progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20028935 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWV      1 - 70
NTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATT     71 - 140
GELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR                                    141 - 178
//

Text Mined References (68)

PMID Year Title
24763822 2014 Loss of function of endothelin-2 leads to reduced ovulation and CL formation.
24647318 2015 The comparison of traditional and modified harvesting techniques of left ?nternal mammary artery regarding endothelin-1/2/3 expression and free flow capacity.
24043815 2013 Endothelin-2 signaling in the neural retina promotes the endothelial tip cell state and inhibits angiogenesis.
23518706 2013 Identification of endothelin 2 as an inflammatory factor that promotes central nervous system remyelination.
22921304 2012 Increased plasma levels of big-endothelin-2 and big-endothelin-3 in patients with end-stage renal disease.
22865632 2013 Epigenetic inactivation of endothelin-2 and endothelin-3 in colon cancer.
22727793 2012 Altered endothelin expression in granulosa-lutein cells of women with polycystic ovary syndrome.
22047647 2012 Expression of endothelin 2 and localized clear cell renal cell carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
More...