Property Summary

NCBI Gene PubMed Count 67
PubMed Score 390.25
PubTator Score 185.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Bradycardia 36 0.0 0.0
Hypotension 82 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 1.3e-06
Breast cancer 3577 8.0e-04
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.100 8.0e-04
malignant mesothelioma 1.300 1.3e-06

Gene RIF (20)

AA Sequence

MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWV      1 - 70
NTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATT     71 - 140
GELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR                                    141 - 178
//

Text Mined References (68)

PMID Year Title