Property Summary

Ligand Count 2
NCBI Gene PubMed Count 25
PubMed Score 15.18
PubTator Score 21.99

Knowledge Summary

Patent (13,583)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 62 3 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.0e-07
lung carcinoma 2843 1.2e-06
lung cancer 4740 1.1e-05
malignant mesothelioma 3232 2.4e-05
group 3 medulloblastoma 4104 4.3e-05
psoriasis 6694 7.0e-04
tuberculosis 2010 3.7e-03
medulloblastoma, large-cell 6241 1.0e-02
ependymoma 4679 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cystoid macular edema 6 4.038 2.0
Vitelliform macular dystrophy 14 3.112 1.6
Disease Target Count
Retinitis Pigmentosa 226

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 2.500 2.3e-02
group 3 medulloblastoma 1.600 4.3e-05
lung cancer -2.200 1.1e-05
lung carcinoma -1.300 1.2e-06
malignant mesothelioma 1.200 2.4e-05
medulloblastoma, large-cell 1.600 1.0e-02
osteosarcoma -2.382 5.0e-07
psoriasis -1.800 7.0e-04
tuberculosis -1.100 3.7e-03

Gene RIF (13)

AA Sequence

MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIR      1 - 70
ENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVK     71 - 140
IADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLFPGTSEVDEIF    141 - 210
KICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALK    211 - 280
HPYFQVGQVLGPSSNHLESKQSLNKQLQPLESKPSLVEVEPKPLPDIIDQVVGQPQPKTSQQPLQPIQPP    281 - 350
QNLSVQQPPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHS    351 - 420
KKPSMGVFKEKRKKDSPFRLPEPVPSGSNHSTGENKSLPAVTSLKSDSELSTAPTSKQYYLKQSRYLPGV    421 - 490
NPKKVSLIASGKEINPHTWSNQLFPKSLGPVGAELAFKRSNAGNLGSYATYNQSGYIPSFLKKEVQSAGQ    491 - 560
RIHLAPLNATASEYTWNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR           561 - 623
//

Text Mined References (25)

PMID Year Title