Property Summary

NCBI Gene PubMed Count 98
PubMed Score 931.67
PubTator Score 400.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.400 3.3e-02
group 3 medulloblastoma 3.000 1.2e-04
non primary Sjogren syndrome sicca 1.100 1.4e-02
ovarian cancer 1.200 3.0e-03
psoriasis -1.200 4.3e-41

Protein-protein Interaction (6)

Gene RIF (78)

AA Sequence

MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPR      1 - 70
EPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYA     71 - 140
EHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDD    141 - 210
KHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT                           211 - 257
//

Text Mined References (99)

PMID Year Title