Property Summary

NCBI Gene PubMed Count 91
Grant Count 644
R01 Count 426
Funding $47,964,915.33
PubMed Score 906.49
PubTator Score 400.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 3.000 0.000
non primary Sjogren syndrome sicca 1.100 0.014
inflammatory breast cancer -1.900 0.000
ovarian cancer 1.200 0.003
psoriasis -1.200 0.000

Synonym

Accession P20783 B7Z1T5 Q6FH50 NT-3
Symbols NT3
HDNF
NGF2
NT-3
NGF-2

Gene

PDB

1BND   1B8K   1NT3   3BUK  

Gene RIF (71)

PMID Text
26814132 The results suggest a gene dose-association between the A allele of rs6332 and the onset of AD in varepsilon4 non-carriers and the NTF-3 rs6489630 polymorphism being a relevant risk factor for AD in patients lacking the ApoE-varepsilon4 allele in this Chinese sample.
25925835 Survival, differentiation, and neuroprotective mechanisms of human stem cells complexed with neurotrophin-3-releasing pharmacologically active microcarriers in an ex vivo model of Parkinson's disease.
25275256 No differences in plasma BDNF, NGF, NT3, NT4 and GDNF were found between autism spectrum disorders and control.
24288162 NT-3 expression was found in axons of olfactory bulb.
23869086 Patients with mastocytosis featured elevated serum levels of NGF, NT-3, and NT-4. TrkA, TrkB, and TrkC expression was also elevated.
23522042 The specific aspects of proprioceptive sensory neuron subtype character is controlled by variation in the level of muscle NT-3 expression.
23471121 genetic variation in the NTF3 gene is related to susceptibility to emotional side effects in response to methylphenidate treatment in Korean children with ADHD.
23426664 NTF3 is transported from midbrain dopaminergic neurons and supports the survival of immature medium-sized spiny neurons.
23185507 we identify a TrkB ligand, neurotrophin 3 (NTF3), as capable of activating TrkB to induce anoikis resistance, and show that NTF3 is also a direct target of miR-200c
23149719 These findings suggest that NT-3, BDNF, LIF and their combinations predominantly support different ontogenetic events at different developmental stages in the innervation of the inner ear.
More...

AA Sequence

MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPR      1 - 70
EPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYA     71 - 140
EHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDD    141 - 210
KHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT                           211 - 257
//

Text Mined References (92)

PMID Year Title
26814132 2015 Polymorphisms of the neurotrophic factor-3 (NTF-3) in Alzheimer's disease: rs6332 associated with onset time and rs6489630 T allele exhibited a protective role.
25925835 2015 Survival, differentiation, and neuroprotective mechanisms of human stem cells complexed with neurotrophin-3-releasing pharmacologically active microcarriers in an ex vivo model of Parkinson's disease.
25416956 2014 A proteome-scale map of the human interactome network.
25275256 2014 Circulating levels of neurotrophic factors in autism spectrum disorders.
24288162 2014 Differential localization of NT-3 and TrpM5 in glomeruli of the olfactory bulb of mice.
23954828 2013 Dok5 is involved in the signaling pathway of neurotrophin-3 against TrkC-induced apoptosis.
23869086 2013 Increased circulating levels of neurotrophins and elevated expression of their high-affinity receptors on skin and gut mast cells in mastocytosis.
23522042 2013 Etv1 inactivation reveals proprioceptor subclasses that reflect the level of NT3 expression in muscle targets.
23471121 2014 Neurotrophin 3 genotype and emotional adverse effects of osmotic-release oral system methylphenidate (OROS-MPH) in children with attention-deficit/hyperactivity disorder.
23426664 2013 Midbrain-derived neurotrophins support survival of immature striatal projection neurons.
More...