Property Summary

NCBI Gene PubMed Count 41
Grant Count 130
R01 Count 74
Funding $32,276,804.7
PubMed Score 557.52
PubTator Score 292.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P20774 Q6FIB0 Q9UF90 Q9UNK5
Symbols OG
OIF
SLRR3A

Gene

OGN

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (17)

PMID Text
26870797 mimecan is a satiety hormone in adipose tissue, and that mimecan inhibits food intake independently of leptin signaling by inducing IL-1beta and IL-6 expression in the hypothalamus.
26206738 Increased plasma mimecan levels are independently associated with increased arterial stiffness in hypertensive patients.
26045825 OIF may be an indicator of the earlier-stage diabetic nephropathy in subjects with type 2 diabetes mellitus
25953442 OGN might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
25463067 The lack of the proteoglycan OGN does not affect the progression of atherosclerosis in mice. Possible causes for the absence of phenotype in the Apoe/Ogn double mutants are discussed.
25371314 Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage.
24651681 Circulating OGN and NGAL/MMP9 complex are promising biomarkers that are expressed in vulnerable atherosclerotic plaques and may have incremental value for prediction of MACE within 1 year after coronary angiography.
23714241 We found that IGF-2 and IGFBP2 synergistically increased neurite outgrowth via enhanced early signaling through the IGF type 1 receptor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS      1 - 70
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA     71 - 140
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK    141 - 210
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG    211 - 280
KHPNSFICLKRLPIGSYF                                                        281 - 298
//

Text Mined References (46)

PMID Year Title
26870797 2015 Mimecan, a Hormone Abundantly Expressed in Adipose Tissue, Reduced Food Intake Independently of Leptin Signaling.
26206738 2015 Serum Mimecan Is Associated With Arterial Stiffness in Hypertensive Patients.
26170933 2015 Overexpression of mimecan in human aortic smooth muscle cells inhibits cell proliferation and enhances apoptosis and migration.
26045825 2015 Osteoinductive factor is a novel biomarker for the diagnosis of early diabetic nephropathy.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
25463067 2014 Osteoglycin deficiency does not affect atherosclerosis in mice.
25371314 2015 Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24651681 2014 Circulating osteoglycin and NGAL/MMP9 complex concentrations predict 1-year major adverse cardiovascular events after coronary angiography.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...