Property Summary

NCBI Gene PubMed Count 48
PubMed Score 604.87
PubTator Score 292.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma -2.559 7.2e-13
astrocytoma -1.100 9.2e-06
Atopic dermatitis -2.100 2.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.280 1.5e-02
Breast cancer -1.100 2.6e-02
breast carcinoma -1.400 7.3e-04
colon cancer -2.100 1.0e-03
diabetes mellitus -1.500 1.4e-02
Duchenne muscular dystrophy 1.546 3.1e-07
ductal carcinoma in situ -1.800 4.2e-02
fibroadenoma -1.300 2.5e-02
intraductal papillary-mucinous adenoma (... -3.900 3.1e-04
intraductal papillary-mucinous carcinoma... -4.000 4.3e-04
intraductal papillary-mucinous neoplasm ... -4.000 5.0e-03
invasive ductal carcinoma -2.383 1.0e-03
juvenile dermatomyositis 1.534 3.7e-07
limb girdle muscular dystrophy 2A 1.265 9.9e-03
lung adenocarcinoma -1.600 3.6e-06
lung cancer -2.300 4.2e-05
lung carcinoma -2.500 8.1e-12
non-small cell lung cancer -2.627 2.1e-16
oligodendroglioma -1.300 8.9e-07
osteosarcoma 3.585 4.0e-02
ovarian cancer -5.800 4.8e-17
pancreatic cancer -1.200 1.7e-02
posterior fossa group A ependymoma 1.500 4.3e-04
primary pancreatic ductal adenocarcinoma 1.164 3.7e-02
primary Sjogren syndrome 1.300 1.5e-03
psoriasis -1.400 1.1e-04
sonic hedgehog group medulloblastoma 2.100 7.1e-03

 GO Function (1)

 IMPC Phenotype (1)

 CSPA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (22)

AA Sequence

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS      1 - 70
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA     71 - 140
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK    141 - 210
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG    211 - 280
KHPNSFICLKRLPIGSYF                                                        281 - 298
//

Text Mined References (53)

PMID Year Title