Property Summary

NCBI Gene PubMed Count 41
PubMed Score 557.52
PubTator Score 292.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Neoplasm Metastasis 138
Disease Target Count P-value
breast carcinoma 1614 1.25280462427407E-29
non-small cell lung cancer 2798 1.22895493894517E-19
ovarian cancer 8492 1.31688668092053E-19
adrenocortical carcinoma 1427 3.14939562954238E-15
lung carcinoma 2844 8.05787819416511E-12
lung adenocarcinoma 2714 2.30951299671465E-10
Duchenne muscular dystrophy 602 2.51729571372197E-7
psoriasis 6685 3.57323790215233E-7
juvenile dermatomyositis 1189 3.74021056242654E-7
oligodendroglioma 2849 8.85373124658712E-7
posterior fossa group B ependymoma 1530 3.46780951373811E-6
astrocytoma 1493 9.22460682540647E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.93277539016996E-5
Atopic dermatitis 944 3.35920078263819E-5
lung cancer 4473 4.15070463075756E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.1516969924662E-5
inflammatory breast cancer 404 3.63915619599634E-4
invasive ductal carcinoma 2950 6.67361653286133E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.32181048184639E-4
colon cancer 1475 0.00100268832559749
primary Sjogren syndrome 789 0.00153288594942274
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00332645766814355
limb girdle muscular dystrophy 2A 156 0.00992380551293629
sonic hedgehog group medulloblastoma 1482 0.0130625691961521
diabetes mellitus 1663 0.0135137249848362
fibroadenoma 557 0.0251248876774428
pancreatic cancer 2300 0.026412242918521
primary pancreatic ductal adenocarcinoma 1271 0.0367644641327293
osteosarcoma 7933 0.0395872486603568
ductal carcinoma in situ 1745 0.0418575343541513
Disease Target Count Z-score Confidence
post-traumatic stress disorder 45 7.539 3.8
Substance abuse 55 4.283 2.1

Expression

Synonym

Accession P20774 Q6FIB0 Q9UF90 Q9UNK5
Symbols OG
OIF
SLRR3A

Gene

OGN

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

 CSPA Cell Line (1)

Gene RIF (17)

PMID Text
26870797 mimecan is a satiety hormone in adipose tissue, and that mimecan inhibits food intake independently of leptin signaling by inducing IL-1beta and IL-6 expression in the hypothalamus.
26206738 Increased plasma mimecan levels are independently associated with increased arterial stiffness in hypertensive patients.
26045825 OIF may be an indicator of the earlier-stage diabetic nephropathy in subjects with type 2 diabetes mellitus
25953442 OGN might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
25463067 The lack of the proteoglycan OGN does not affect the progression of atherosclerosis in mice. Possible causes for the absence of phenotype in the Apoe/Ogn double mutants are discussed.
25371314 Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage.
24651681 Circulating OGN and NGAL/MMP9 complex are promising biomarkers that are expressed in vulnerable atherosclerotic plaques and may have incremental value for prediction of MACE within 1 year after coronary angiography.
23714241 We found that IGF-2 and IGFBP2 synergistically increased neurite outgrowth via enhanced early signaling through the IGF type 1 receptor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS      1 - 70
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA     71 - 140
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK    141 - 210
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG    211 - 280
KHPNSFICLKRLPIGSYF                                                        281 - 298
//

Text Mined References (46)

PMID Year Title
26870797 2015 Mimecan, a Hormone Abundantly Expressed in Adipose Tissue, Reduced Food Intake Independently of Leptin Signaling.
26206738 2015 Serum Mimecan Is Associated With Arterial Stiffness in Hypertensive Patients.
26170933 2015 Overexpression of mimecan in human aortic smooth muscle cells inhibits cell proliferation and enhances apoptosis and migration.
26045825 2015 Osteoinductive factor is a novel biomarker for the diagnosis of early diabetic nephropathy.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
25463067 2014 Osteoglycin deficiency does not affect atherosclerosis in mice.
25371314 2015 Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24651681 2014 Circulating osteoglycin and NGAL/MMP9 complex concentrations predict 1-year major adverse cardiovascular events after coronary angiography.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...