Property Summary

NCBI Gene PubMed Count 95
Grant Count 87
R01 Count 55
Funding $9,256,926.51
PubMed Score 282.31
PubTator Score 234.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -1.100 0.017
medulloblastoma, large-cell -1.200 0.000
Atopic dermatitis 1.100 0.000
tuberculosis -1.200 0.006
intraductal papillary-mucinous neoplasm ... 1.200 0.024
lung cancer -3.100 0.000
interstitial cystitis 1.100 0.001
posterior fossa group A ependymoma 1.100 0.001
subependymal giant cell astrocytoma 1.258 0.039
psoriasis 1.300 0.000
non-inflammatory breast cancer 1.200 0.001
lung carcinoma -1.100 0.000
ovarian cancer 1.500 0.000
head and neck cancer 1.200 0.039

Synonym

Accession P20749 BCL-3
Symbols BCL4
D19S37

Gene

PDB

1K1A   1K1B  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2049 screening 8 / 0 / 7 Late stage results from the probe development effort to identify activators of signal transducer and activator of transcription 3 (STAT3).

Gene RIF (65)

PMID Text
26526716 Bcl3 reduces the inflammatory response in pancreas/biliary tissue by blocking ubiquitination and proteasome-mediated degradation of nuclear factor-kappaB p50 homodimers.
26138292 Bcl-3 is involved in the development of Tfh cells and the pathogenesis of RA, presumably by inducing IL-21 production.
26122346 Variant of BCL3 gene is strongly associated with five-year survival of non-small-cell lung cancer patients
25929479 Subcellular localization of Bcl-3 could be a potential-early diagnostic marker in colon cancer.
25922067 data show that BCL-3 makes extensive contacts with p50 homodimers and in particular with ankyrin repeats (ANK) 1, 6, and 7, and the N-terminal region of Bcl-3.
25873381 These findings suggest that the two LMP1 signaling domains modulate their combined activity and that the bcl3 transcription factor is likely responsible for some of the unique effects of CTAR1 domain on cellular expression.
25374339 Suggest the involvement of BCL3 in cardiovascular disease, which could be partly mediated through the influence on metabolic phenotypes.
24867235 DC-SIGN directs adaptive T helper cell type-2immunity to fucose-expressing pathogens via an IKKepsilon-CYLD-dependent signalling pathway leading to Bcl3 activation.
24162774 HIV-1 gp120 upregulates the expression of B-cell CLL/lymphoma 3 (BCL3) in human B cells
24130828 a delayed (incoherent) feed-forward loop together with differential rates of TNFA (fast) and BCL3 (slow) mRNA turnover provide robust, pulsatile expression of TNFalpha
More...

AA Sequence

MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPLRGGCDLPAVP      1 - 70
GPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLH     71 - 140
IAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAH    141 - 210
LACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPL    211 - 280
IHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVAR    281 - 350
SRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN    351 - 420
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS                                        421 - 454
//

Text Mined References (97)

PMID Year Title
26526716 2016 BCL3 Reduces the Sterile Inflammatory Response in Pancreatic and Biliary Tissues.
26138292 2015 Role of Bcl-3 in the development of follicular helper T cells and in the pathogenesis of rheumatoid arthritis.
26122346 2015 Variant of BCL3 gene is strongly associated with five-year survival of non-small-cell lung cancer patients.
25929479 2015 Early diagnostic value of Bcl-3 localization in colorectal cancer.
25922067 2015 Mapping the Interaction of B Cell Leukemia 3 (BCL-3) and Nuclear Factor ?B (NF-?B) p50 Identifies a BCL-3-mimetic Anti-inflammatory Peptide.
25873381 2015 Changes in expression induced by Epstein-Barr Virus LMP1-CTAR1: potential role of bcl3.
25374339 2015 An integrated genomic-transcriptomic approach supports a role for the proto-oncogene BCL3 in atherosclerosis.
24867235 2014 Fucose-specific DC-SIGN signalling directs T helper cell type-2 responses via IKK?- and CYLD-dependent Bcl3 activation.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24130828 2013 BCL-3 attenuation of TNFA expression involves an incoherent feed-forward loop regulated by chromatin structure.
More...