Property Summary

NCBI Gene PubMed Count 101
PubMed Score 291.26
PubTator Score 234.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis 1.100 3.1e-04
head and neck cancer 1.200 3.9e-02
interstitial cystitis 1.100 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
lung cancer -2.300 7.1e-06
lung carcinoma -1.100 1.9e-06
medulloblastoma, large-cell -1.200 9.2e-05
non-inflammatory breast cancer 1.200 6.3e-04
osteosarcoma -1.100 1.7e-02
ovarian cancer 1.500 3.5e-04
posterior fossa group A ependymoma 1.100 1.2e-03
psoriasis -1.200 1.2e-05
subependymal giant cell astrocytoma 1.258 3.9e-02
tuberculosis -1.200 6.1e-03

Gene RIF (71)

AA Sequence

MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPLRGGCDLPAVP      1 - 70
GPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLH     71 - 140
IAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAH    141 - 210
LACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPL    211 - 280
IHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVAR    281 - 350
SRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN    351 - 420
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS                                        421 - 454
//

Text Mined References (103)

PMID Year Title