Property Summary

NCBI Gene PubMed Count 28
Grant Count 4
R01 Count 2
Funding $134,575.5
PubMed Score 145.31
PubTator Score 74.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 0.002
medulloblastoma, large-cell 1.400 0.000
lung cancer -2.200 0.000
adult high grade glioma 1.400 0.001
ovarian cancer 1.100 0.000

Gene RIF (7)

PMID Text
25737043 The data of this study link the finding of elevated serum PZP levels with the characteristic Alzheimer's Disease pathology and identify PZP as a novel component in Alzheimer's Disease.
21879768 Quantitative measurements using a multiple reaction monitoring assay showed a significant increase in plasma pregnancy-zone protein in presymptomatic Alzheimer disease compared with controls
20708005 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19105203 Observational study of gene-disease association. (HuGE Navigator)
17257854 A new purification methodology was used on the C-terminal peptide fragment of PZP.
11811950 Differential binding to ldl receptor related protein

AA Sequence

MRKDRLLHLCLVLLLILLSASDSNSTEPQYMVLVPSLLHTEAPKKGCVLLSHLNETVTVSASLESGRENR      1 - 70
SLFTDLVAEKDLFHCVSFTLPRISASSEVAFLSIQIKGPTQDFRKRNTVLVLNTQSLVFVQTDKPMYKPG     71 - 140
QTVRFRVVSVDENFRPRNELIPLIYLENPRRNRIAQWQSLKLEAGINQLSFPLSSEPIQGSYRVVVQTES    141 - 210
GGRIQHPFTVEEFVLPKFEVKVQVPKIISIMDEKVNITVCGEYTYGKPVPGLATVSLCRKLSRVLNCDKQ    211 - 280
EVCEEFSQQLNSNGCITQQVHTKMLQITNTGFEMKLRVEARIREEGTDLEVTANRISEITNIVSKLKFVK    281 - 350
VDSHFRQGIPFFAQVLLVDGKGVPIPNKLFFISVNDANYYSNATTNEQGLAQFSINTTSISVNKLFVRVF    351 - 420
TVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYTLNRQAMGELSELS    421 - 490
FHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDSEKFEIENCL    491 - 560
ANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSVSSVYNLLTVKDLTNFPDNV    561 - 630
DQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGY    631 - 700
YGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITE    701 - 770
WKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQLKASPAF    771 - 840
LASQNTKGEESYCICGNERQTLSWTVTPKTLGNVNFSVSAEAMQSLELCGNEVVEVPEIKRKDTVIKTLL    841 - 910
VEAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGE    911 - 980
QNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFGERYGRNQGNTWLTAF    981 - 1050
VLKTFAQARSYIFIDEAHITQSLTWLSQMQKDNGCFRSSGSLLNNAIKGGVEDEATLSAYVTIALLEIPL   1051 - 1120
PVTNPIVRNALFCLESAWNVAKEGTHGSHVYTKALLAYAFSLLGKQNQNREILNSLDKEAVKEDNLVHWE   1121 - 1190
RPQRPKAPVGHLYQTQAPSAEVEMTSYVLLAYLTAQPAPTSGDLTSATNIVKWIMKQQNAQGGFSSTQDT   1191 - 1260
VVALHALSRYGAATFTRTEKTAQVTVQDSQTFSTNFQVDNNNLLLLQQISLPELPGEYVITVTGERCVYL   1261 - 1330
QTSMKYNILPEKEDSPFALKVQTVPQTCDGHKAHTSFQISLTISYTGNRPASNMVIVDVKMVSGFIPLKP   1331 - 1400
TVKMLERSSSVSRTEVSNNHVLIYVEQVTNQTLSFSFMVLQDIPVGDLKPAIVKVYDYYETDESVVAEYI   1401 - 1470
APCSTDTEHGNV                                                             1471 - 1482
//

Text Mined References (34)

PMID Year Title
25737043 2015 Pregnancy Zone Protein is Increased in the Alzheimer's Disease Brain and Associates with Senile Plaques.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21879768 2011 Serum levels of pregnancy zone protein are elevated in presymptomatic Alzheimer's disease.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...