Property Summary

NCBI Gene PubMed Count 50
Grant Count 45
R01 Count 27
Funding $8,798,733.28
PubMed Score 113.12
PubTator Score 75.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

 GO Component (1)

Gene RIF (29)

PMID Text
26678341 In colon cancer, HOXA5 is downregulated, and its re-expression induces loss of the cancer stem cell phenotype, preventing tumor progression and metastasis.
26397212 Downregulation of HOXA5 by shRNA may trigger apoptosis and overcome drug resistance in leukemia cells.
26219418 HOXA5-induced apoptosis was p53-independent.
25987065 Increased expression of HOXA5 is associated with acute myeloid leukemia.
25979369 Among the mechanosensitive genes, the two transcription factors, HoxA5 and Klf3, contain cAMP-response-elements methylation of which could serve as a mechanosensitive master switch in gene expression in atherosclerosis. (Review)
25875824 Ectopic expression of HOXA5 in highly invasive cancer cells suppressed cell migration, invasion, and filopodia formation in vitro and inhibited metastatic potential in vivo.
25686496 miR-1271 regulates non-small-cell lung cancer cell proliferation and invasion, via the down-regulation of HOXA5.
25585874 The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients.
25549794 Our findings present that decreased HOXA5 could be identified as a poor prognostic biomarker in nonsmall cell lung cancer and regulate cell proliferation and invasion
22876840 Our analysis showed that miR-196a suppressed the expression of HOXA5 both at the mRNA and protein levels; knockdown of HOXA5 expression in A549 cells using RNAi was shown to promote NSCLC cell proliferation, migration and invasion.
More...

AA Sequence

MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERA      1 - 70
RSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSR     71 - 140
EGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLEL    141 - 210
EKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP              211 - 270
//

Text Mined References (51)

PMID Year Title
26678341 2015 HOXA5 Counteracts Stem Cell Traits by Inhibiting Wnt Signaling in Colorectal Cancer.
26397212 2015 Knockdown of homeobox A5 by small hairpin RNA inhibits proliferation and enhances cytarabine chemosensitivity of acute myeloid leukemia cells.
26219418 2015 Induction of p53-independent apoptosis by ectopic expression of HOXA5 in human liposarcomas.
25987065 2015 Aberrant Expression of HOXA5 and HOXA9 in AML.
25979369 2015 The role of epigenetics in the endothelial cell shear stress response and atherosclerosis.
25875824 2015 HOXA5 inhibits metastasis via regulating cytoskeletal remodelling and associates with prolonged survival in non-small-cell lung carcinoma.
25686496 2015 miR-1271 promotes non-small-cell lung cancer cell proliferation and invasion via targeting HOXA5.
25585874 2015 Promoter DNA methylation and expression levels of HOXA4, HOXA5 and MEIS1 in acute myeloid leukemia.
25549794 2015 HOXA5 indicates poor prognosis and suppresses cell proliferation by regulating p21 expression in non small cell lung cancer.
22876840 2012 MicroRNA-196a promotes non-small cell lung cancer cell proliferation and invasion through targeting HOXA5.
More...