Property Summary

NCBI Gene PubMed Count 24
Grant Count 3
R01 Count 3
Funding $559,956
PubMed Score 65.76
PubTator Score 38.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P20718 G3V2C5 Q6XGZ0 Q6XGZ1
Symbols CCP-X
CGL-2
CSP-C
CTLA1
CTSGL2

Gene

PANTHER Protein Class (3)

PDB

1LXV   3TJU   3TJV   3TK9   4GAW  

Gene RIF (14)

PMID Text
23352961 Granzyme H did directly process DFF45, potentially leading to DNA damage.
23269243 Upon reactive center loop cleavage at Phe-343,SERPINB1 covalently complexes with GzmH. SERPINB1 overexpression suppresses GzmH- or LAK cell-mediated cytotoxicity. Crystal structures show possible conformational changes in GzmH for the suicide inhibition.
22156497 An unusual RKR motif (Arg39-Lys40-Arg41), conserved only in GzmH, helps define the S3' and S4' binding regions, indicating the preference for acidic residues at the P3' and P4' sites.
22156339 GzmH suppresses viral replication through association with the hepatitis B virus x protein.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19039329 Cleavage of La protein by granzyme H generates a COOH-terminal truncated form of La protein that loses nuclear localization and decreases hepatitis C virus-internal ribosome entry site-mediated translational activity.
17766182 Granzyme H could have evolved a proteolytic specificity that both interferes directly with adenovirus replication and prevents the virus from blocking the potent pro-apoptotic activity of granzyme B.
17765974 GzmH may play an essential role in caspase-dependent pathogen clearance in the innate immunity that may complement the proapoptotic function of GzmB in human NK cells.
More...

AA Sequence

MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSI      1 - 70
NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQ     71 - 140
LCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD    141 - 210
VAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL                                      211 - 246
//

Text Mined References (25)

PMID Year Title
25342632 2014 Granzyme H is a novel protease expressed by human mast cells.
25250148 2014 Granzyme h serum levels variations with both reproductive hormone receptors, and related hormone receptors in breast cancer patients.
23352961 2013 Granzyme H induces cell death primarily via a Bcl-2-sensitive mitochondrial cell death pathway that does not require direct Bid activation.
23269243 2013 Identification of SERPINB1 as a physiological inhibitor of human granzyme H.
22156497 2012 Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif.
22156339 2012 Granzyme H of cytotoxic lymphocytes is required for clearance of the hepatitis B virus through cleavage of the hepatitis B virus X protein.
19946888 2010 Defining the membrane proteome of NK cells.
19039329 2009 Cleavage of La protein by granzyme H induces cytoplasmic translocation and interferes with La-mediated HCV-IRES translational activity.
19024195 To study the significance of apoptotic enzyme granzyme H in breast cancer patients.
17766182 2007 H is for helper: granzyme H helps granzyme B kill adenovirus-infected cells.
More...