Property Summary

NCBI Gene PubMed Count 24
PubMed Score 70.94
PubTator Score 38.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Common variable immunodeficiency 1.678 6.5e-03
cutaneous lupus erythematosus 2.200 3.1e-04
head and neck cancer and chronic obstruc... 1.100 4.0e-02
interstitial cystitis 1.800 1.8e-02
intraductal papillary-mucinous carcinoma... -1.100 3.5e-04
lung adenocarcinoma -1.700 1.1e-06
lung cancer -1.400 7.9e-04
nasopharyngeal carcinoma 1.100 9.7e-03
non-small cell lung cancer -1.596 7.1e-13
osteosarcoma -3.086 2.3e-03
psoriasis 1.300 1.2e-02
tuberculosis 1.700 8.2e-05
type I diabetes mellitus -1.179 1.3e-02

Gene RIF (14)

AA Sequence

MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSI      1 - 70
NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQ     71 - 140
LCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD    141 - 210
VAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL                                      211 - 246
//

Text Mined References (25)

PMID Year Title