Property Summary

Ligand Count 1
NCBI Gene PubMed Count 103
PubMed Score 593.31
PubTator Score 620.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 1.7
Malaria 160 0.0 0.9

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.740 2.1e-02
esophageal adenocarcinoma 1.800 2.1e-02
intraductal papillary-mucinous adenoma (... -1.500 1.1e-02
lung carcinoma 4.100 4.8e-17
medulloblastoma, large-cell 1.400 3.7e-04
nephrosclerosis -1.829 1.4e-02
pancreatic ductal adenocarcinoma liver m... -1.316 2.8e-02
psoriasis -4.200 2.5e-41
ulcerative colitis -1.500 2.3e-04

Gene RIF (83)

AA Sequence

MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH      1 - 70
WHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEG     71 - 140
GGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIP    141 - 210
SDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI    211 - 280
CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ    281 - 350
IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN    351 - 420
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE              421 - 480
//

Text Mined References (105)

PMID Year Title