Property Summary

NCBI Gene PubMed Count 96
Grant Count 115
R01 Count 56
Funding $45,595,093.74
PubMed Score 575.12
PubTator Score 620.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P20711 C9IYA0 E7ER62 E7EU95 Q16723 Q5W5T9 Q75MJ6 AADC
Symbols AADC

Gene

DDC

PANTHER Protein Class (2)

PDB

3RBF   3RBL   3RCH  

Gene RIF (76)

PMID Text
25721989 The data showed that L-DOPA decarboxylase constitutes a highly promising molecular marker for renal cell carcinoma.
25597765 A novel homozygous DDC variant in syndromic intellectual disability patients, c.1123C>T, resulting in p.Arg375Cys missense substitution.
25445287 Results indicate that miR-145 has the ability to regulate DDC mRNA expression and potentially this occurs by recognizing its mRNA as a target.
25017620 gene study of 987 BPD cases and 1110 healthy controls found an association between BPD [ borderline personality disorder ]and single nucleotide polymorphism rs12718541 in the dopa decarboxylase gene
24865461 Results revealed the general picture of structural and/or functional effects of each DDC mutation linked to AADC deficiency mutations and help to guide therapeutic decision and prevent inappropriate use of treatment regiments.
24411733 The data of this study confirm histidine decarboxylase deficiency as a rare cause of TS and identify HA-DA interactions in the basal ganglia as an important locus of pathology.
24216088 Our results suggest that DDC may be a genetic modifier of the l-dopa response in Parkinson's disease
24163823 assessed variants in four genes, DDC (rs3837091 and rs3735273), DRD2 (rs1800496, rs1801028, and rs1799732), DRD4 (rs4646984 and rs4646983), and COMT (rs165599 and rs740603) in Indian ADHD subjects with comorbid attributes
23953852 8 SNPs in DDC gene showed significant associations with MaxDrinks.
23781496 Absorbance and fluorescence titrations of hDDC-bound coenzyme identify a single pK(spec) of ~7.2.
More...

AA Sequence

MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH      1 - 70
WHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEG     71 - 140
GGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIP    141 - 210
SDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI    211 - 280
CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ    281 - 350
IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN    351 - 420
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE              421 - 480
//

Text Mined References (98)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25721989 2015 L-DOPA decarboxylase mRNA levels provide high diagnostic accuracy and discrimination between clear cell and non-clear cell subtypes in renal cell carcinoma.
25597765 2015 Syndromic intellectual disability: a new phenotype caused by an aromatic amino acid decarboxylase gene (DDC) variant.
25445287 2015 Human L-DOPA decarboxylase mRNA is a target of miR-145: A prediction to validation workflow.
25223841 2014 A genetic locus in 7p12.2 associated with treatment resistant schizophrenia.
25017620 2014 Association between dopa decarboxylase gene variants and borderline personality disorder.
24865461 2014 A comprehensive picture of the mutations associated with aromatic amino acid decarboxylase deficiency: from molecular mechanisms to therapy implications.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24411733 2014 Histidine decarboxylase deficiency causes tourette syndrome: parallel findings in humans and mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...