Property Summary

NCBI Gene PubMed Count 91
Grant Count 438
R01 Count 280
Funding $48,596,711.94
PubMed Score 1540.32
PubTator Score 583.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
cutaneous lupus erythematosus 1.900 0.008
psoriasis -1.600 0.000
osteosarcoma -3.021 0.000
glioblastoma 1.100 0.000
non-small cell lung cancer -1.028 0.000
interstitial cystitis 1.100 0.009
invasive ductal carcinoma 1.200 0.002
lung carcinoma -2.400 0.000
mucosa-associated lymphoid tissue lympho... 1.436 0.022
ductal carcinoma in situ 1.100 0.009
facioscapulohumeral dystrophy 2.500 0.002

Synonym

Accession P20702 Q8IVA6
Symbols CD11C
SLEB6

Gene

PDB

1N3Y   2LUV   3K6S   3K71   3K72   4NEH   4NEN   5ES4  

Gene RIF (64)

PMID Text
26927560 Data show that the percentage of CD11c positive antigen presenting cells (CD11c(+) APCs) in the peripheral blood of active pulmonary tuberculosis (APT) patients was much higher than that in the controls.
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26309367 High expression of CD11c decreased the risk of death and relapse, and may be regarded as an alternative indicator of favorable prognosis in patients with gastric cancer.
26306739 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18.
26255872 the CD11c molecule possesses four different cellular patterns in the periprosthetic tissues.
26153037 Data suggest that blood neutrophils expressing CD11c antigen and EMR2 protein be considered as potential biomarkers for sepsis and systemic inflammatory response syndrome (SIRS), respectively.
25411967 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients.
25361058 infiltration of MBP(+) and CD11c(+) innate immune cells show a significant association with phenotype and disease extent of non-asthmatic chronic rhinosinusitis
25278023 LFA-1 and CR4 alpha chain phosphorylation is needed for chemokine-induced cross-talk to VLA-4
25231265 beta2 integrins-mediated chemosensory adhesion and migration of polymorphonuclear leukocytes on the vascular graft surface, bacterial cellulose.
More...

AA Sequence

MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCG      1 - 70
YSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPV     71 - 140
SRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSS    141 - 210
NPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAG    211 - 280
IIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELE    281 - 350
MAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL    351 - 420
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGG    421 - 490
QVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVL    491 - 560
GPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPA    561 - 630
EIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL    631 - 700
SRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKN    701 - 770
CGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ    771 - 840
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTS    841 - 910
KTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQE    911 - 980
AVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGN    981 - 1050
LSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLL   1051 - 1120
ALITAVLYKVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK                              1121 - 1163
//

Text Mined References (94)

PMID Year Title
26927560 2016 [The number of peripheral blood CD11c+ antigen presenting cells increases and their function strengthens in the patients with active pulmonary tuberculosis].
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26309367 2015 High expression of CD11c indicates favorable prognosis in patients with gastric cancer.
26306739 2015 Secreted aspartic protease 2 of Candida albicans inactivates factor H and the macrophage factor H-receptors CR3 (CD11b/CD18) and CR4 (CD11c/CD18).
26255872 2016 Expression of CD11c in periprosthetic tissues from failed total hip arthroplasties.
26153037 2015 Expression of CD11c and EMR2 on neutrophils: potential diagnostic biomarkers for sepsis and systemic inflammation.
25411967 2014 A systems genetics approach identifies CXCL14, ITGAX, and LPCAT2 as novel aggressive prostate cancer susceptibility genes.
25361058 2014 MBP-positive and CD11c-positive cells are associated with different phenotypes of Korean patients with non-asthmatic chronic rhinosinusitis.
25278023 2014 Specific phosphorylations transmit signals from leukocyte ?2 to ?1 integrins and regulate adhesion.
25231265 2015 ?2 integrins (CD11/18) are essential for the chemosensory adhesion and migration of polymorphonuclear leukocytes on bacterial cellulose.
More...