Property Summary

NCBI Gene PubMed Count 97
PubMed Score 1600.59
PubTator Score 583.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Leukemia, Promyelocytic, Acute 36 0.0 0.0
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.5
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 3.0

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.600 3.4e-04
cutaneous lupus erythematosus 1.900 8.0e-03
ductal carcinoma in situ 1.100 9.2e-03
facioscapulohumeral dystrophy 2.500 1.8e-03
glioblastoma 1.100 5.0e-05
interstitial cystitis 1.100 8.7e-03
invasive ductal carcinoma 1.132 2.5e-04
lung carcinoma -2.400 2.1e-24
malignant mesothelioma 1.400 3.5e-07
mucosa-associated lymphoid tissue lympho... 1.436 2.2e-02
non-small cell lung cancer -1.028 3.2e-14
osteosarcoma -3.021 1.1e-05

Gene RIF (69)

AA Sequence

MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCG      1 - 70
YSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPV     71 - 140
SRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSS    141 - 210
NPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAG    211 - 280
IIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELE    281 - 350
MAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL    351 - 420
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGG    421 - 490
QVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVL    491 - 560
GPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPA    561 - 630
EIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL    631 - 700
SRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKN    701 - 770
CGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ    771 - 840
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTS    841 - 910
KTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQE    911 - 980
AVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGN    981 - 1050
LSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLL   1051 - 1120
ALITAVLYKVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK                              1121 - 1163
//

Text Mined References (100)

PMID Year Title