Property Summary

NCBI Gene PubMed Count 158
Grant Count 101
R01 Count 63
Funding $7,235,386.73
PubMed Score 749.25
PubTator Score 1456.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
ulcerative colitis 1.800 0.000
cutaneous lupus erythematosus 3.000 0.000
osteosarcoma -4.542 0.000
periodontitis 1.300 0.000
glioblastoma 1.200 0.024
Atopic dermatitis 1.100 0.023
tuberculosis 1.500 0.000
non-small cell lung cancer -1.609 0.000
lung cancer -2.700 0.000
interstitial cystitis 2.100 0.004
pediatric high grade glioma 1.300 0.001
pilocytic astrocytoma 1.300 0.000
primary Sjogren syndrome 1.100 0.009
psoriasis 1.100 0.000
COPD -1.200 0.001
lung carcinoma -2.700 0.000
spina bifida 1.000 0.039

Synonym

Accession P20701 O43746 Q45H73 Q96HB1 Q9UBC8
Symbols CD11A
LFA-1
LFA1A

Gene

PDB

3BN3   1CQP   1DGQ   1IJ4   1LFA   1MJN   1MQ8   1MQ9   1MQA   1RD4   1T0P   1XDD   1XDG   1XUO   1ZON   1ZOO   1ZOP   2ICA   2K8O   2M3E   2O7N   3BQM   3BQN   3E2M   3EOA   3EOB   3F74   3F78   3HI6   3M6F   3TCX   4IXD   5E6R   5E6S   5E6U  

 GWAS Trait (1)

Gene RIF (148)

PMID Text
26936951 The alphaI domain, tethered through its N-linker and a disulfide to a stable beta-ribbon pillar near the center of the platform, can undergo pivoting and tilting motions that appear buffered by N-glycan decorations that differ between alphaL and alphaX subunits.
26884833 Suggest possible role for lymphocyte CD11a in the pathogenesis immune thrombocytopenia.
26216891 Data show that interleukin-18 was involved in the eosinophil-mediated death of colon carcinoma cells via upregulation of CD11a/CD18 and ICAM-1 adhesion molecules.
25684021 Data show that leucocyte function-associated antigen-1 (integrin alphaLbeta2), DNAX accessory molecule-1 (DNAM-1) or tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) enhance osteoclast survival when co-cultured with activated NK cells.
25678252 the blocking of LFA-1/ICAM-1 interaction resulted in a significant increase in the percentage of IL-17(+) T cells expanded in nonclassical monocyte/T-cell cocultures
25378583 LFA-1 function is regulated through conformational changes that include the modulation of ligand binding affinity and molecular extension.
25231265 beta2 integrins-mediated chemosensory adhesion and migration of polymorphonuclear leukocytes on the vascular graft surface, bacterial cellulose.
25155097 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behcet's disease in Koreans.
25147050 Studied signaling mechanisms of Lymphocyte function-associated antigen-1 (LFA-1) using NMR analysis of the dynamics of the LFA-1 I-domain.
24982892 PIK3R3, ITGB1, ITGAL, and ITGA6, were involved in the regulation of actin cytoskeleton that link to triple-negative breast cancer migration.
More...

AA Sequence

MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSL      1 - 70
YQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPM     71 - 140
LQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSD    141 - 210
YVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDII    211 - 280
RYIIGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELS    281 - 350
SSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL    351 - 420
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQR    421 - 490
GGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGG    491 - 560
LSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVAVGAESQMIVLSSRPVVDMVTLMSFSPAEIP    561 - 630
VHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIA    631 - 700
VTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKN    701 - 770
CGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ    771 - 840
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLED    841 - 910
NSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPS    911 - 980
EGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS    981 - 1050
LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRN   1051 - 1120
LKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD                       1121 - 1170
//

Text Mined References (165)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26936951 2016 Leukocyte integrin ?L?2 headpiece structures: The ?I domain, the pocket for the internal ligand, and concerted movements of its loops.
26884833 2015 Expression of CD11a in lymphocyte subpopulation in immune thrombocytopenia.
26216891 2015 IL-18 Is Involved in Eosinophil-Mediated Tumoricidal Activity against a Colon Carcinoma Cell Line by Upregulating LFA-1 and ICAM-1.
25684021 2015 Interleukin-15-activated natural killer cells kill autologous osteoclasts via LFA-1, DNAM-1 and TRAIL, and inhibit osteoclast-mediated bone erosion in vitro.
25678252 2015 Blocking of LFA-1 enhances expansion of Th17 cells induced by human CD14(+) CD16(++) nonclassical monocytes.
25378583 2015 FRET detection of lymphocyte function-associated antigen-1 conformational extension.
25231265 2015 ?2 integrins (CD11/18) are essential for the chemosensory adhesion and migration of polymorphonuclear leukocytes on bacterial cellulose.
25155097 2014 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behçet's disease in Koreans.
25147050 2014 NMR characterization of the conformational fluctuations of the human lymphocyte function-associated antigen-1 I-domain.
More...