Property Summary

NCBI Gene PubMed Count 87
Grant Count 27
R01 Count 21
Funding $5,560,035.66
PubMed Score 359.51
PubTator Score 158.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (55)

PMID Text
26876308 Data show that lamins A and B are differently processed in staurosporine and beta-Amyloid peptide fragments Abeta42-treated cells.
26311780 Lamin B1 levels are increased in oligodendrocytes, the cell type that produces myelin in the central nervous system.
26053668 LMNB1-related autosomal-dominant leukodystrophy is a slowly progressive neurological disease with survival lasting more than two decades after clinical onset.
25807068 The tail domain of lamin B1 is more strongly modulated by divalent cations than lamin A.
25733566 Data indicate that lamin B1 promotes DNA double-strand breaks (DSBs) repair and cell survival.
25701871 An upstream mutation alters LMNB1 gene expression in autosomal dominant adult-onset demyelinating leukodystrophy.
25637521 Deregulation of LMNB1 expression induces modified splicing of several genes, likely driven by raver-2 overexpression, and suggest that an alteration of mRNA processing could be a pathogenic mechanism in adult-onset autosomal dominant leukodystrophy.
25535332 maintenance of lamin B1 levels is required for DNA replication and repair through regulation of the expression of key factors involved in these essential nuclear functions
25477337 Nuclear envelope remodelling during human spermiogenesis involves somatic B-type lamins and a spermatid-specific B3 lamin isoform.
24858279 Lamin B1 overexpression increases nuclear rigidity in autosomal dominant leukodystrophy fibroblasts.
More...

AA Sequence

MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEV      1 - 70
RGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEA     71 - 140
ALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKS    141 - 210
MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE    211 - 280
MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR    281 - 350
DQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD    351 - 420
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVL    421 - 490
KAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEA    491 - 560
AGVVVEEELFHQQGTPRASNRSCAIM                                                561 - 586
//

Text Mined References (107)

PMID Year Title
27697922 2016 Nuclear envelope rupture is induced by actin-based nucleus confinement.
26876308 2016 ?-Amyloid induces nuclear protease-mediated lamin fragmentation independent of caspase activation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26311780 2015 Defects of Lipid Synthesis Are Linked to the Age-Dependent Demyelination Caused by Lamin B1 Overexpression.
26053668 2015 LMNB1-related autosomal-dominant leukodystrophy: Clinical and radiological course.
25807068 2015 The tail domain of lamin B1 is more strongly modulated by divalent cations than lamin A.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25733566 2015 Regulation of homologous recombinational repair by lamin B1 in radiation-induced DNA damage.
25701871 2015 A large genomic deletion leads to enhancer adoption by the lamin B1 gene: a second path to autosomal dominant adult-onset demyelinating leukodystrophy (ADLD).
25637521 2015 Messenger RNA processing is altered in autosomal dominant leukodystrophy.
More...