Property Summary

NCBI Gene PubMed Count 95
PubMed Score 373.49
PubTator Score 158.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 1.0
Disease Target Count Z-score Confidence
adult-onset autosomal dominant demyelinating leukodystrophy 10 0.0 5.0

Expression

  Differential Expression (27)

Disease log2 FC p
active ulcerative colitis -1.101 2.2e-02
adrenocortical carcinoma 1.506 1.2e-03
adult high grade glioma 1.500 7.6e-03
astrocytoma 1.100 1.9e-08
Astrocytoma, Pilocytic 1.400 1.1e-03
Atopic dermatitis 1.900 2.0e-05
atypical teratoid / rhabdoid tumor 1.900 4.4e-04
Breast cancer 1.700 4.2e-11
breast carcinoma 1.600 3.1e-31
ductal carcinoma in situ 2.100 1.2e-04
Endometriosis 1.241 1.9e-02
ependymoma 1.200 6.5e-03
glioblastoma 2.500 9.1e-07
group 3 medulloblastoma 4.800 5.0e-07
interstitial cystitis 1.700 1.6e-03
intraductal papillary-mucinous carcinoma... 1.700 5.1e-04
intraductal papillary-mucinous neoplasm ... 1.800 4.1e-03
invasive ductal carcinoma 2.400 3.6e-04
lung adenocarcinoma 1.300 1.0e-04
lung cancer 1.800 5.7e-04
malignant mesothelioma 1.600 2.1e-07
medulloblastoma, large-cell 2.700 1.5e-05
non-small cell lung cancer 1.059 9.0e-14
oligodendroglioma 1.300 1.9e-06
primitive neuroectodermal tumor 3.000 2.1e-05
psoriasis 1.500 2.8e-172
Rheumatoid arthritis 1.800 4.0e-02

Gene RIF (59)

AA Sequence

MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEV      1 - 70
RGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEA     71 - 140
ALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKS    141 - 210
MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE    211 - 280
MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR    281 - 350
DQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD    351 - 420
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVL    421 - 490
KAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEA    491 - 560
AGVVVEEELFHQQGTPRASNRSCAIM                                                561 - 586
//

Text Mined References (117)

PMID Year Title