Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1570.71
PubTator Score 13.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 1.07091721137101E-4
glioblastoma 5572 1.30963614800783E-4
Multiple myeloma 1328 0.00146865940540191
ovarian cancer 8492 0.00366872006650743
astrocytic glioma 2241 0.0181229575882553
ependymoma 2514 0.033590367359648

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.490 0.001
astrocytic glioma -1.500 0.018
ependymoma -1.500 0.034
glioblastoma -1.100 0.000
lung cancer 1.300 0.000
ovarian cancer 1.600 0.004

Synonym

Accession P20674 P30045 Q8TB65
Symbols VA
COX
COX-VA

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
22748147 Our current study showed that COX Va may play a role in migration and invasion of NSCLC cells and can be used as a biomarker to predict aggressiveness of NSCLC.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22190034 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
20307258 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 5a
19834492 Data show that Bcl-2 expression positively influences the targeting of nuclear-encoded COX Va and Vb to the mitochondria of cancer cells.
14607829 study points to a role for surfeit 1(SURF1) in promoting the association of cytochrome c oxidase II with the cytochrome c oxidase I.cytochrome c oxidase subunit 4.cytochrome c oxidase subunit 5A subassembly

AA Sequence

MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWEL      1 - 70
RKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGIS     71 - 140
TPEELGLDKV                                                                141 - 150
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22748147 2012 The role of cytochrome c oxidase subunit Va in non-small cell lung carcinoma cells: association with migration, invasion and prediction of distant metastasis.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20307258 2010 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 4, 5a, 6a, 7a and 7b.
19834492 2010 Involvement of cytochrome c oxidase subunits Va and Vb in the regulation of cancer cell metabolism by Bcl-2.
More...