Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1612.94
PubTator Score 13.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
ependymoma -1.500 3.4e-02
glioblastoma -1.100 1.3e-04
lung cancer 1.100 7.3e-04
Multiple myeloma 1.490 1.5e-03
ovarian cancer 1.600 3.7e-03

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (7)

AA Sequence

MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWEL      1 - 70
RKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGIS     71 - 140
TPEELGLDKV                                                                141 - 150
//

Text Mined References (22)

PMID Year Title