Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5994.12
PubTator Score 382.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 7.92358893516128E-8
pancreatic cancer 2300 6.63010338292332E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00530114556631093
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0464152813865062
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (4)

Synonym

Accession P20648 O00738
Symbols ATP6A

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (6)

PMID Text
25678551 Homozygous missense mutation in the 14th exon of the ATP4A gene (c.2107C>T) is responsible for an atypical familial type I gastric neuroendocrine tumour.
24773566 ATP4A are found in nearly one-third of children with type 1 diabetes and more common among females. In this cross-sectional analysis, Hp infection was not associated with autoimmunity against parietal cells.
23317218 Downregulation of ATP4A gene is associated with gastric cancer.
19705497 cigarette smoke extract may cause an increase in the amount and activity of H,K-ATPase and smokers' susceptibility to development of peptic ulcer
18772363 study concludes that IL-1beta upregulates HKalpha transcription by inducing Sp1 binding to HKalpha Sp1 & NF-kappaB sites & that Helicobacter pylori perturbation of HKalpha expression is independent of Sp1-mediated basal HKalpha transcription
15962365 Gastric H+/K+-ATPase activities are not associated with H pylori status in patients with chronic gastritis.

AA Sequence

MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSA      1 - 70
TKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDN     71 - 140
LYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRV    141 - 210
PADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGR    211 - 280
IASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLAT    281 - 350
VTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ    351 - 420
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYRDRFPKVCE    421 - 490
IPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLG    491 - 560
ERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGD    561 - 630
HPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMV    631 - 700
FARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIV    701 - 770
TGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES    771 - 840
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQ    841 - 910
DSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVCIGCFL    911 - 980
CYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY                   981 - 1035
//

Text Mined References (18)

PMID Year Title
25678551 2015 Exome sequencing identifies ATP4A gene as responsible of an atypical familial type I gastric neuroendocrine tumour.
24773566 2014 ATP4A autoimmunity and Helicobacter pylori infection in children with type 1 diabetes.
23317218 2012 Intragenic DNA methylation concomitant with repression of ATP4B and ATP4A gene expression in gastric cancer is a potential serum biomarker.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
19705497 2009 Dysregulation of gastric H,K-ATPase by cigarette smoke extract.
18772363 2008 The role of Sp1 in IL-1beta and H. pylori-mediated regulation of H,K-ATPase gene transcription.
15962365 2005 Direct measurement of gastric H+/K+-ATPase activities in patients with or without Helicobacter pylori-associated chronic gastritis.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743830 2004 Molecular and cellular regulation of the gastric proton pump.
More...