Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
R01 Count 3
Funding $167,571.16
PubMed Score 5994.12
PubTator Score 382.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (69)

Disease Z-score Confidence
Gastroesophageal reflux disease 37 8.785 4.0
Peptic ulcer disease 11 7.948 4.0
Esophagitis 26 7.88 3.9
Dyspepsia 34 7.325 3.7
Barrett's esophagus 183 6.7 3.3
Hiatus hernia 7 6.68 3.3
Gastritis 44 6.606 3.3
Laryngitis 2 5.986 3.0
Zollinger-Ellison Syndrome 14 5.75 2.9
Diarrhea 155 5.308 2.7
Achalasia 11 5.057 2.5
Cancer 2,346 4.835 2.4
Bile reflux 8 4.794 2.4
Pneumonia 133 4.759 2.4
Allergic hypersensitivity disease 123 4.688 2.3
Eosinophilia 65 4.649 2.3
Duodenitis 8 4.477 2.2
Coronary artery disease 240 4.368 2.2
Dyskinesia of esophagus 3 4.368 2.2
Gastric outlet obstruction 6 4.186 2.1
Asthma 349 4.141 2.1
Irritable bowel syndrome 59 4.033 2.0
Vitamin B12 deficiency 20 3.902 2.0
Osteoporosis 257 3.881 1.9
Constipation 43 3.872 1.9
Kidney disease 396 3.836 1.9
Inflammatory bowel disease 142 3.748 1.9
Anemia 252 3.647 1.8
Liver disease 219 3.626 1.8
Osteopetrosis 40 3.625 1.8
Duodenogastric reflux 8 3.587 1.8
Gastroparesis 20 3.577 1.8
Gastric antral vascular ectasia 11 3.559 1.8
Cerebrovascular disease 231 3.525 1.8
Arthritis 248 3.408 1.7
diabetes mellitus 1,663 3.406 1.7
Peritonitis 37 3.399 1.7
Pernicious anemia 10 3.383 1.7
Hypersensitivity reaction type II diseas... 235  3.334 1.7
X-linked myopathy with excessive autopha... 2  3.319 1.7
Esophageal atresia 25 3.277 1.6
Pain disorder 13 3.202 1.6
Chronic intestinal vascular insufficienc... 12  3.149 1.6
Gastroenteritis 46 3.104 1.6
Esophageal varix 10 3.072 1.5
Varicose veins 15 3.035 1.5
Carcinoma 2,147 1.0
Duodenal Ulcer due to H. Pylori 7
Duodenal ulcer disease 7
Erosive esophagitis 6
Gastric Hypersecretory Conditions 5
Gastric ulcer 34
Gastro-esophageal reflux disease with es... 3 
Maintenance of Healing Duodenal Ulcer 7
Maintenance of Healing Erosive Esophagit... 2 
Maintenance of Healing Gastroesophageal ... 2 
Multiple endocrine adenomas 3
NSAID-Induced Gastric Ulcer 4
Osteoarthritis in Patients at High Ulcer... 7 
Pathological Gastric Hypersecretory Cond... 2 
Peptic reflux disease 4
Peptic ulcer 22
Prevention of NSAID-Induced Gastric Ulce... 3 
Rheumatoid Arthritis in Patient at High ... 7 
Systemic mast cell disease 12
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
ovarian cancer 8,484
pancreatic cancer 2,300

Expression

  Differential Expression (4)

Synonym

Accession P20648 O00738
Symbols ATP6A

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25678551 Homozygous missense mutation in the 14th exon of the ATP4A gene (c.2107C>T) is responsible for an atypical familial type I gastric neuroendocrine tumour.
24773566 ATP4A are found in nearly one-third of children with type 1 diabetes and more common among females. In this cross-sectional analysis, Hp infection was not associated with autoimmunity against parietal cells.
23317218 Downregulation of ATP4A gene is associated with gastric cancer.
19705497 cigarette smoke extract may cause an increase in the amount and activity of H,K-ATPase and smokers' susceptibility to development of peptic ulcer
18772363 study concludes that IL-1beta upregulates HKalpha transcription by inducing Sp1 binding to HKalpha Sp1 & NF-kappaB sites & that Helicobacter pylori perturbation of HKalpha expression is independent of Sp1-mediated basal HKalpha transcription
15962365 Gastric H+/K+-ATPase activities are not associated with H pylori status in patients with chronic gastritis.

AA Sequence

MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSA      1 - 70
TKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDN     71 - 140
LYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRV    141 - 210
PADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGR    211 - 280
IASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLAT    281 - 350
VTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ    351 - 420
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYRDRFPKVCE    421 - 490
IPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLG    491 - 560
ERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGD    561 - 630
HPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMV    631 - 700
FARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIV    701 - 770
TGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES    771 - 840
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQ    841 - 910
DSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVCIGCFL    911 - 980
CYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY                   981 - 1035
//

Text Mined References (18)

PMID Year Title
25678551 2015 Exome sequencing identifies ATP4A gene as responsible of an atypical familial type I gastric neuroendocrine tumour.
24773566 2014 ATP4A autoimmunity and Helicobacter pylori infection in children with type 1 diabetes.
23317218 2012 Intragenic DNA methylation concomitant with repression of ATP4B and ATP4A gene expression in gastric cancer is a potential serum biomarker.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
19705497 2009 Dysregulation of gastric H,K-ATPase by cigarette smoke extract.
18772363 2008 The role of Sp1 in IL-1beta and H. pylori-mediated regulation of H,K-ATPase gene transcription.
15962365 2005 Direct measurement of gastric H+/K+-ATPase activities in patients with or without Helicobacter pylori-associated chronic gastritis.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743830 2004 Molecular and cellular regulation of the gastric proton pump.
More...