Property Summary

Ligand Count 10
NCBI Gene PubMed Count 20
PubMed Score 6458.60
PubTator Score 382.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Peptic ulcer disease 11 8.013 4.0
Esophagitis 35 7.96 4.0
Dyspepsia 33 7.377 3.7
Hiatus hernia 7 6.769 3.4
Barrett's esophagus 182 6.736 3.4
Gastritis 47 6.654 3.3
Laryngitis 2 6.004 3.0
Diarrhea 253 5.406 2.7
Achalasia 13 5.18 2.6
Cancer 2499 4.914 2.5
Pneumonia 174 4.88 2.4
Dyskinesia of esophagus 10 4.859 2.4
Allergic hypersensitivity disease 126 4.85 2.4
Bile reflux 9 4.806 2.4
Hypereosinophilic syndrome 71 4.804 2.4
Duodenitis 7 4.523 2.3
Coronary artery disease 268 4.437 2.2
Gastric outlet obstruction 6 4.26 2.1
Asthma 385 4.225 2.1
Irritable bowel syndrome 60 4.104 2.1
Kidney disease 430 4.038 2.0
Constipation 181 3.959 2.0
Osteoporosis 363 3.947 2.0
Vitamin B12 deficiency 20 3.917 2.0
Inflammatory bowel disease 151 3.89 1.9
Liver disease 237 3.86 1.9
Anemia 365 3.767 1.9
Cerebrovascular disease 238 3.696 1.8
Osteopetrosis 43 3.666 1.8
Gastric antral vascular ectasia 10 3.641 1.8
Gastroparesis 22 3.62 1.8
Duodenogastric reflux 8 3.594 1.8
Peritonitis 43 3.563 1.8
diabetes mellitus 1728 3.563 1.8
Hypersensitivity reaction type II disease 253 3.473 1.7
Arthritis 290 3.451 1.7
Pernicious anemia 9 3.421 1.7
Pain disorder 15 3.349 1.7
Chronic intestinal vascular insufficiency 12 3.345 1.7
Gastroenteritis 41 3.343 1.7
X-linked myopathy with excessive autophagy 2 3.305 1.7
Esophageal atresia 43 3.284 1.6
Varicose veins 20 3.217 1.6
Atrial Fibrillation 124 3.161 1.6
Dementia 175 3.151 1.6
Esophageal varix 12 3.1 1.5
Candidiasis 55 3.024 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.700 5.3e-03
intraductal papillary-mucinous neoplasm ... -1.600 4.6e-02
ovarian cancer 1.100 7.9e-08
pancreatic cancer -1.300 6.6e-04

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSA      1 - 70
TKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDN     71 - 140
LYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRV    141 - 210
PADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGR    211 - 280
IASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLAT    281 - 350
VTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ    351 - 420
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYRDRFPKVCE    421 - 490
IPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLG    491 - 560
ERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGD    561 - 630
HPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMV    631 - 700
FARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIV    701 - 770
TGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES    771 - 840
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQ    841 - 910
DSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVCIGCFL    911 - 980
CYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY                   981 - 1035
//

Text Mined References (20)

PMID Year Title