Property Summary

NCBI Gene PubMed Count 43
Grant Count 81
R01 Count 42
Funding $7,429,737.16
PubMed Score 367.47
PubTator Score 118.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.212 0.004
Multiple myeloma 1.181 0.000
osteosarcoma 1.576 0.001
glioblastoma 1.400 0.004
lung adenocarcinoma 1.173 0.001
ovarian cancer 2.100 0.000

Synonym

Accession P20645 A8K528 D3DUV5 CD Man-6-P receptor
Symbols SMPR
MPR46
CD-MPR
MPR 46
MPR-46
CD-M6PR

Gene

PANTHER Protein Class (1)

PDB

1JUQ  

Gene RIF (14)

PMID Text
24788816 Results suggest that Rab protein Rab29 is essential for the integrity of the trans-Golgi network (TGN) and participates in the retrograde trafficking of mannose-6-phosphate receptor (M6PR).
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
22768187 Sortilin is a new alpha-Gal A receptor expressed in renal endothelial cells and that this receptor together with the M6PR is able to internalize circulating alpha-Gal A.
22163010 Mannose receptor (MR) engagement by mesothelin GPI anchor polarizes tumor-associated macrophages and is blocked by anti-MR human recombinant antibody
22015004 mediates in vitro human immunodeficiency virus and sperm cell interaction
20351714 Observational study of gene-disease association. (HuGE Navigator)
19345684 Data demonstrate that Rab31 is required for transport of mannose 6-phosphate receptors from the trans-Golgi network to endosomes and for the Golgi/TGN organization.
18367545 Missorting of cathepsin D in GARP-depleted cells results from accumulation of recycling MPRs in a population of light, small vesicles downstream of endosomes.
18088323 sortilin and mannose-6-phosphate receptors recycle to the TGN in SNX1-dependent carriers, which we named endosome-to-TGN transport carriers
18003638 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT      1 - 70
YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV     71 - 140
VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY    141 - 210
QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM       211 - 277
//

Text Mined References (48)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24788816 2014 A role of Rab29 in the integrity of the trans-Golgi network and retrograde trafficking of mannose-6-phosphate receptor.
24407285 2014 Clathrin terminal domain-ligand interactions regulate sorting of mannose 6-phosphate receptors mediated by AP-1 and GGA adaptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22768187 2012 Mannose 6-phosphate receptor and sortilin mediated endocytosis of ?-galactosidase A in kidney endothelial cells.
22163010 2011 Mannose receptor (MR) engagement by mesothelin GPI anchor polarizes tumor-associated macrophages and is blocked by anti-MR human recombinant antibody.
22015004 2011 In vitro human immunodeficiency virus and sperm cell interaction mediated by the mannose receptor.
21269460 2011 Initial characterization of the human central proteome.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
More...