Property Summary

NCBI Gene PubMed Count 44
PubMed Score 405.87
PubTator Score 118.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.400 3.9e-03
lung adenocarcinoma 1.173 8.1e-04
Multiple myeloma 1.181 1.3e-04
osteosarcoma 1.576 7.2e-04
ovarian cancer 1.100 4.4e-03
Waldenstrons macroglobulinemia 1.212 3.6e-03

Gene RIF (15)

AA Sequence

MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT      1 - 70
YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV     71 - 140
VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY    141 - 210
QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM       211 - 277
//

Text Mined References (49)

PMID Year Title