Property Summary

NCBI Gene PubMed Count 41
PubMed Score 16.18
PubTator Score 12.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.260 0.003
Multiple myeloma 1.963 0.000
glioblastoma 1.200 0.008
pancreatic ductal adenocarcinoma liver m... -1.357 0.032
colon cancer 1.500 0.042
ovarian cancer 3.500 0.000
dermatomyositis 1.300 0.000

Synonym

Accession P20618 B5BU76 Q9BWA8
Symbols HC5
PSC5
PMSB1

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

Gene RIF (35)

PMID Text
23924720 The mutated form of PSMB1 displayed increased nuclear translocation, resulting in activation of transcription in adipocytes.
23725357 The proteasome beta1 subunit plays a novel role in tumorigenesis by degrading p27Kip1.
23549871 Follicular lymphoma patients with PSMB1 P11A (G allele) and low CD68 expression have significantly longer progression free survival with bortezomib-rituximab versus rituximab.
23544109 PSMB1 is part of the transcriptional machinery required for gastrin stimulated expression of PAI-2 and Reg1.
23504381 The proteasome was found to be activated in primary sjogren syndrome, with upregulation of gene expression of catalytic proteasome subunits.
20558726 data defined a unique motif of BCL-3 that is needed for its recruitment to the proteasome and identified PSMB1 as a key protein required for the proteasome-mediated degradation of a nuclear and oncogenic IkappaB protein.
19549367 Expression of 26S proteasome beta(1)-subunit in NB4 cells increased after incubation with As(2)O(3).
15848047 Observational study of gene-disease association. (HuGE Navigator)
14614829 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14564014 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
More...

AA Sequence

MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPK      1 - 70
CYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGG     71 - 140
LDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISA    141 - 210
AERDVYTGDALRICIVTKEGIREETVSLRKD                                           211 - 241
//

Text Mined References (48)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23924720 2013 Role of nuclear localization of PSMB1 in transcriptional activation.
23725357 2013 A novel role of proteasomal ?1 subunit in tumorigenesis.
23549871 2013 Prespecified candidate biomarkers identify follicular lymphoma patients who achieved longer progression-free survival with bortezomib-rituximab versus rituximab.
23544109 2013 The role of proteasome beta subunits in gastrin-mediated transcription of plasminogen activator inhibitor-2 and regenerating protein1.
23504381 2013 Gene expression of catalytic proteasome subunits and resistance toward proteasome inhibition of B lymphocytes from patients with primary sjogren syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...