Property Summary

NCBI Gene PubMed Count 163
PubMed Score 1123.39
PubTator Score 571.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple Sclerosis 3.100 2.7e-03
dermatomyositis 3.200 8.1e-04
Atopic dermatitis 1.500 2.2e-03
Breast cancer 1.700 4.3e-03
breast carcinoma 1.200 3.5e-15
cutaneous lupus erythematosus 3.900 2.5e-06
cystic fibrosis 2.587 1.5e-03
group 3 medulloblastoma -1.700 1.7e-03
intraductal papillary-mucinous neoplasm ... 2.200 4.0e-03
invasive ductal carcinoma 1.400 2.6e-02
juvenile dermatomyositis 4.404 8.0e-25
lung cancer -2.700 6.7e-05
lung carcinoma -1.900 1.2e-13
malignant mesothelioma 1.500 1.5e-04
medulloblastoma, large-cell -1.500 3.7e-05
Multiple myeloma 1.883 2.7e-03
ovarian cancer 2.100 9.0e-04
pancreatic cancer 1.600 3.1e-04
primary pancreatic ductal adenocarcinoma 1.087 2.6e-02
primary Sjogren syndrome 2.100 5.7e-04
psoriasis 2.700 8.8e-09
subependymal giant cell astrocytoma 1.514 4.0e-02
Systemic lupus erythematosus 1.800 1.0e-04
ulcerative colitis 1.400 3.6e-04

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (144)

AA Sequence

MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLAL      1 - 70
PAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVE     71 - 140
KEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQE    141 - 210
TISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKC    211 - 280
RGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH    281 - 350
QRITEELQKYGVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN    351 - 420
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIK    421 - 490
NFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWD    491 - 560
FGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLL    561 - 630
KERSDTSDKRKFLKERLARLTQARRRLAQFPG                                          631 - 662
//

Text Mined References (167)

PMID Year Title