Property Summary

NCBI Gene PubMed Count 155
PubMed Score 1065.10
PubTator Score 571.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 7.95000147448951E-25
breast carcinoma 1614 3.51937745041181E-15
lung carcinoma 2844 1.16968692794879E-13
cutaneous lupus erythematosus 1056 2.4903993437069E-6
medulloblastoma, large-cell 6234 3.73835853568117E-5
lung cancer 4473 6.67841959407223E-5
systemic lupus erythematosus 172 1.03628297199909E-4
malignant mesothelioma 3163 1.49252975124264E-4
psoriasis 6685 2.18845464196851E-4
pancreatic cancer 2300 3.10687644095776E-4
ulcerative colitis 2087 3.63911141279085E-4
primary Sjogren syndrome 789 5.73792591268875E-4
ovarian cancer 8492 8.96328786730242E-4
cystic fibrosis 1670 0.00154299219498551
group 3 medulloblastoma 2254 0.00169800708908908
Atopic dermatitis 944 0.00218051872399908
Multiple myeloma 1328 0.00265247892519284
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00398021262238691
Breast cancer 3099 0.00430859211249005
primary pancreatic ductal adenocarcinoma 1271 0.025594146653904
invasive ductal carcinoma 2950 0.0260378190543263
subependymal giant cell astrocytoma 2287 0.0402707461474118

Expression

  Differential Expression (24)

Synonym

Accession P20591 B2RDA5 B3KU10 C9IYV7 C9J8D6 C9JN19 C9JN88 C9JUL1 C9JZS6 D3DSI8 Q86YP5 Q96CI3
Symbols MX
MxA
IFI78
IFI-78K

Gene

MX1

PDB

3ZYS   3LJB   3SZR   4P4S   4P4T   4P4U  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 GWAS Trait (1)

Gene RIF (137)

PMID Text
26857498 This study demonstrated that MxA mRNA expression of interferon beta response in multiple sclerosis patients.
26507657 data suggest that, during infection, a fraction of MxA disassembles into dimers that bind to NP synthesized following primary transcription in the cytoplasm, thereby preventing viral replication
26175399 E2F1 transcripts and miR-17-5p were significantly downregulated while c-Myc and MxA transcripts were significantly upregulated in SLE.
26116899 HIV-1 Vpr upregulates the gene expression of MX1 in human monocyte-derived dendritic cells
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1, and IFIT-3 expression.
25868067 polymorphism at position -88 in the MxA promoter region might be a potential biomarker to predict HCV progression toward end-stage fibrosis and response to IFN-based therapy in chronic hepatitis C patients.
25829498 study highlights the role of nucleotide binding and hydrolysis for the intracellular dynamics of MxA during its antiviral action.
25542463 Blood MxA protein levels are increased in young children with symptomatic respiratory virus infections, including rhinovirus infections. MxA is an informative general marker for the most common acute virus infections.
25447205 MxA interacts with Ubc9 and SUMO1 in a yeast two-hybrid system.
25396411 Baseline MxA mRNA levels may be useful for predicting whether multiple sclerosis patients will respond or not to interferon-beta treatment.
More...

AA Sequence

MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLAL      1 - 70
PAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVE     71 - 140
KEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQE    141 - 210
TISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKC    211 - 280
RGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH    281 - 350
QRITEELQKYGVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN    351 - 420
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIK    421 - 490
NFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWD    491 - 560
FGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLL    561 - 630
KERSDTSDKRKFLKERLARLTQARRRLAQFPG                                          631 - 662
//

Text Mined References (159)

PMID Year Title
26857498 2016 MxA mRNA expression as a biomarker of interferon beta response in multiple sclerosis patients.
26507657 2015 Oligomerization and GTP-binding Requirements of MxA for Viral Target Recognition and Antiviral Activity against Influenza A Virus.
26175399 2015 Targeting E2F1 and c-Myc expression by microRNA-17-5p represses interferon-stimulated gene MxA in peripheral blood mononuclear cells of pediatric systemic lupus erythematosus patients.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25868067 2015 Association of Myxovirus Resistance Gene Promoter Polymorphism with Response to Combined Interferon Treatment and Progression of Liver Disease in Chronic HCV Egyptian Patients.
25829498 2015 Role of nucleotide binding and GTPase domain dimerization in dynamin-like myxovirus resistance protein A for GTPase activation and antiviral activity.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25542463 2015 Blood MxA protein as a marker for respiratory virus infections in young children.
25447205 2015 MxA interacts with and is modified by the SUMOylation machinery.
25416956 2014 A proteome-scale map of the human interactome network.
More...