Property Summary

NCBI Gene PubMed Count 34
PubMed Score 2337.91
PubTator Score 849.58

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.400 0.000
pancreatic cancer 1.600 0.003
malignant mesothelioma 2.600 0.000
astrocytic glioma -1.900 0.002
ependymoma -4.300 0.000
glioblastoma -3.900 0.000
group 3 medulloblastoma -4.600 0.000
atypical teratoid/rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -3.800 0.001
primitive neuroectodermal tumor -3.700 0.002
Amyotrophic Lateral Sclerosis 1.800 0.000
interstitial cystitis -1.500 0.006
adult high grade glioma -4.000 0.000
pilocytic astrocytoma -4.100 0.000
pancreatic carcinoma 1.600 0.003
subependymal giant cell astrocytoma -5.650 0.002
Down syndrome -1.600 0.002


Accession P20472 B2R4H7 P78378 Q4VB78 Q5R3Q9
Symbols D22S749



1RJV   1RK9  

  Ortholog (13)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid
Zebrafish OMA EggNOG

 GO Function (1)

Gene RIF (19)

26081613 Increased numbers of PVALB neurons and fiber labeling in focal cortical dysplasia compared to nondysplastic epileptic temporal neocortex and postmortem controls may be related to cortical malformation.
24764033 TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve
24628518 This study demonistrated that differentially expressed in PV neurons in subjects with schizophrenia, including genes associated with WNT (wingless-type), NOTCH, and PGE2 (prostaglandin E2) signaling.
24217255 This study showed that the parvalbumin basket cell inputs in the dorsolateral prefrontal cortex were lower in patient with schizophrenia.
23891794 mRNA labeling at the single cell level shows a significant decrease in parvalbumin expression in Parkinson's (PD) cases; however, neuronal density of parvalbumin-positive neurons was not significantly different between PD patients and controls.
23825418 Parvalbumin neurons decrease the drive of the input to the visual cortex in contrast sensitivity.
23764361 This study demonistrated that loss of parvalbium immunoreactive axons in anterolateral columns of spinal cord in patient of lateral sclerosis spinal cords
23254904 A subpopulation of projection neurons containing calcium-binding protein parvalbumin (PV) is identified in a precise mapping of the GABAergic cortical distribution.
22272358 Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum.
20926528 PVALB is a novel diagnostic marker for Hurthle ademonas of the thyroid.

AA Sequence

FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES                                   71 - 110

Text Mined References (36)

PMID Year Title
26081613 2015 Calcium-binding proteins in focal cortical dysplasia.
24764033 2014 Distribution of TRPVs, P2X3, and parvalbumin in the human nodose ganglion.
24628518 Molecular profiles of parvalbumin-immunoreactive neurons in the superior temporal cortex in schizophrenia.
24217255 2014 Altered parvalbumin basket cell inputs in the dorsolateral prefrontal cortex of schizophrenia subjects.
23891794 2013 Decreased parvalbumin mRNA expression in dorsolateral prefrontal cortex in Parkinson's disease.
23825418 2013 Contrast dependence and differential contributions from somatostatin- and parvalbumin-expressing neurons to spatial integration in mouse V1.
23764361 2013 Loss of calretinin- and parvalbumin-immunoreactive axons in anterolateral columns beyond the corticospinal tracts of amyotrophic lateral sclerosis spinal cords.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23254904 2013 Distribution and intrinsic membrane properties of basal forebrain GABAergic and parvalbumin neurons in the mouse.