Property Summary

NCBI Gene PubMed Count 39
PubMed Score 2499.50
PubTator Score 849.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -4.000 1.3e-05
Amyotrophic lateral sclerosis 1.800 2.1e-05
astrocytic glioma -1.900 2.4e-03
Astrocytoma, Pilocytic -4.100 6.1e-08
atypical teratoid / rhabdoid tumor -4.000 1.9e-09
Down syndrome -1.600 2.5e-03
ependymoma -2.100 4.0e-03
gastric cancer 1.400 2.8e-04
glioblastoma -3.900 1.6e-11
group 3 medulloblastoma -4.600 9.1e-05
interstitial cystitis -1.500 5.9e-03
malignant mesothelioma 2.600 1.4e-07
medulloblastoma, large-cell -3.800 8.9e-04
pancreatic cancer 1.600 3.0e-03
pancreatic carcinoma 1.600 3.0e-03
primitive neuroectodermal tumor -3.700 2.2e-03
subependymal giant cell astrocytoma -5.650 1.9e-03

Gene RIF (24)

AA Sequence

MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG      1 - 70
FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES                                   71 - 110
//

Text Mined References (41)

PMID Year Title