Property Summary

NCBI Gene PubMed Count 50
PubMed Score 1859.61
PubTator Score 2496.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

  Differential Expression (4)

Disease log2 FC p
primitive neuroectodermal tumor 1.100 0.033
group 3 medulloblastoma 1.700 0.005
pilocytic astrocytoma 2.100 0.001
lung carcinoma 1.800 0.000

Synonym

Accession P20396 B2R8R1 Q2TB83 Pro-TRH
Symbols TRF
Pro-TRH

Gene

TRH

  Ortholog (6)

Gene RIF (20)

PMID Text
25485475 Data indicate that decrease of cholesterol level impaired the functional coupling between the thyrotropin-releasing hormone receptor and the cognate G proteins.
25362934 TRH rs13097335 may have a protective role toward the development of breast cancer.
24010162 TRH, LH-RH and substance P are not affected in Alzheimer disease and Down's syndrome.
22378876 TRH inhibits melanin-concentrating hormone (MCH) neurons by increasing synaptic inhibition from local GABA neurons.
21956127 This study introduces TRH as a novel, potent, selective, and evolutionarily highly conserved neuroendocrine factor controlling human pigmentation in situ.
20687402 Case Report: Isolated idiopathic central hypothyroidism in an adult, possibly caused by thyrotropin releasing hormone (TRH) deficiency.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS      1 - 70
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR     71 - 140
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL    141 - 210
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE                                          211 - 242
//

Text Mined References (51)

PMID Year Title
25485475 2015 TRH-receptor mobility and function in intact and cholesterol-depleted plasma membrane of HEK293 cells stably expressing TRH-R-eGFP.
25362934 2015 Biased paternal transmission of TRH variant to female Down syndrome probands: possible correlation with low breast cancer frequency.
24010162 1983 Thyrotropin-releasing hormone, luteinizing hormone-releasing hormone and substance P immuno-reactivity in post-mortem brain from cases of Alzheimer-type dementia and Down's syndrome.
23585666 2013 The dynamic pituitary response to escalating-dose TRH stimulation test in hypothyroid patients treated with liothyronine or levothyroxine replacement therapy.
23524276 2013 Expression of hypothalamic regulatory peptides in thyroid C cells of different mammals.
23387883 2012 Cancer-related fatigue, inflammation and thyrotropin-releasing hormone.
23373458 2013 Is thyrotropin-releasing hormone a novel neuroendocrine modulator of keratin expression in human skin?
23248581 2012 Desensitization, trafficking, and resensitization of the pituitary thyrotropin-releasing hormone receptor.
23215350 2013 siRNA screen identifies the phosphatase acting on the G protein-coupled thyrotropin-releasing hormone receptor.
23146791 2012 Thyroid axis alterations in childhood obesity.
More...