Property Summary

NCBI Gene PubMed Count 50
Grant Count 314
R01 Count 197
Funding $49,662,904.12
PubMed Score 1859.61
PubTator Score 2496.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primitive neuroectodermal tumor 1.100 0.033
group 3 medulloblastoma 1.700 0.005
pilocytic astrocytoma 2.100 0.001
lung carcinoma 1.800 0.000

Synonym

Accession P20396 B2R8R1 Q2TB83 Pro-TRH
Symbols TRF
Pro-TRH

Gene

TRH

Gene RIF (20)

PMID Text
25485475 Data indicate that decrease of cholesterol level impaired the functional coupling between the thyrotropin-releasing hormone receptor and the cognate G proteins.
25362934 TRH rs13097335 may have a protective role toward the development of breast cancer.
24010162 TRH, LH-RH and substance P are not affected in Alzheimer disease and Down's syndrome.
22378876 TRH inhibits melanin-concentrating hormone (MCH) neurons by increasing synaptic inhibition from local GABA neurons.
21956127 This study introduces TRH as a novel, potent, selective, and evolutionarily highly conserved neuroendocrine factor controlling human pigmentation in situ.
20687402 Case Report: Isolated idiopathic central hypothyroidism in an adult, possibly caused by thyrotropin releasing hormone (TRH) deficiency.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS      1 - 70
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR     71 - 140
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL    141 - 210
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE                                          211 - 242
//

Text Mined References (51)

PMID Year Title
25485475 2015 TRH-receptor mobility and function in intact and cholesterol-depleted plasma membrane of HEK293 cells stably expressing TRH-R-eGFP.
25362934 2015 Biased paternal transmission of TRH variant to female Down syndrome probands: possible correlation with low breast cancer frequency.
24010162 1983 Thyrotropin-releasing hormone, luteinizing hormone-releasing hormone and substance P immuno-reactivity in post-mortem brain from cases of Alzheimer-type dementia and Down's syndrome.
23585666 2013 The dynamic pituitary response to escalating-dose TRH stimulation test in hypothyroid patients treated with liothyronine or levothyroxine replacement therapy.
23524276 2013 Expression of hypothalamic regulatory peptides in thyroid C cells of different mammals.
23387883 2012 Cancer-related fatigue, inflammation and thyrotropin-releasing hormone.
23373458 2013 Is thyrotropin-releasing hormone a novel neuroendocrine modulator of keratin expression in human skin?
23248581 2012 Desensitization, trafficking, and resensitization of the pituitary thyrotropin-releasing hormone receptor.
23215350 2013 siRNA screen identifies the phosphatase acting on the G protein-coupled thyrotropin-releasing hormone receptor.
23146791 2012 Thyroid axis alterations in childhood obesity.
More...