Property Summary

NCBI Gene PubMed Count 50
PubMed Score 1828.15
PubTator Score 2496.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 2.2e-03
group 3 medulloblastoma 1.700 4.9e-03
lung carcinoma 1.800 7.0e-14
primitive neuroectodermal tumor 1.100 3.3e-02

Gene RIF (20)

AA Sequence

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS      1 - 70
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR     71 - 140
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL    141 - 210
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE                                          211 - 242
//

Text Mined References (51)

PMID Year Title