Property Summary

NCBI Gene PubMed Count 59
Grant Count 13
R01 Count 5
Funding $1,501,894.58
PubMed Score 212.91
PubTator Score 865.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.691 0.000
lung cancer 4.000 0.001
atypical teratoid/rhabdoid tumor 1.700 0.028
psoriasis 1.500 0.002

Gene RIF (17)

PMID Text
23884861 MCH is an anabolic neuropeptide with multiple and diverse physiological functions including a key role in energy homoeostasis; evidence suggests that, in the reproductive context, MCH is a modulator rather than a primary regulator.
23667582 Cerebrospinal fluid (CSF) levels were measured in 33 patients with Alzheimer's disease (AD) and 33 healthy subjects, to investigate the role of MCH and HCRT-1 in AD.
23462990 the changes in the levels of two hypothalamic neuropeptides, hypocretin-1 and melanin-concentrating hormone, measured in the human amygdala, are reported.
22295972 Melanin-concentrating hormone (MCH) neurons of human hypothalamus, as well as the MCH neurons of mouse hypothalamus, contain IL-6Ralpha.
20888736 PMCH mRNA expression level was increased 1.85 times (P < 0.01) in vitiligo uninvolved skin and 5.36 times (P < 0.01) in involved skin compared to healthy control skin.
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18650383 MCH has a role in inflammatory processes in the intestine
18498421 The total number of hypocretin-1 neurons was significantly reduced by 30% in HD brains (P = 0.015), while the total number of MCH neurons was not significantly altered (P = 0.100).
17640905 expression of PMCH by activated Th2 cells in vivo may directly link allergic inflammation to energy homeostasis and may contribute to the association between asthma and obesity
More...

AA Sequence

MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDE      1 - 70
SSFMNEEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAK     71 - 140
FPIGRRDFDMLRCMLGRVYRPCWQV                                                 141 - 165
//

Text Mined References (60)

PMID Year Title
25868673 2015 Ubiquitous expression and multiple functions of biologically active peptides.
23884861 2013 The roles of melanin-concentrating hormone in energy balance and reproductive function: Are they connected?
23667582 2013 Cerebrospinal fluid melanin-concentrating hormone (MCH) and hypocretin-1 (HCRT-1, orexin-A) in Alzheimer's disease.
23538494 2013 Anti-melanin-concentrating hormone treatment attenuates chronic experimental colitis and fibrosis.
23462990 2013 Human hypocretin and melanin-concentrating hormone levels are linked to emotion and social interaction.
22295972 2012 Interleukin-6 receptor ? is co-localised with melanin-concentrating hormone in human and mouse hypothalamus.
21697009 2011 Melanin concentrating hormone in central hypersomnia.
20888736 2010 Analysis of the expression profile of CRH-POMC system genes in vitiligo skin biopsies.
20886624 2010 Expression patterns of corticotropin-releasing factor, arginine vasopressin, histidine decarboxylase, melanin-concentrating hormone, and orexin genes in the human hypothalamus.
20518952 2010 The role of orexigenic and anorexigenic factors in an interdisciplinary weight loss therapy for obese adolescents with symptoms of eating disorders.
More...