Property Summary

NCBI Gene PubMed Count 59
PubMed Score 211.17
PubTator Score 865.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.700 2.8e-02
lung cancer 4.000 7.5e-04
malignant mesothelioma 1.200 4.7e-06
osteosarcoma -1.691 3.4e-05
psoriasis 1.500 1.8e-03

Protein-protein Interaction (13)

Gene RIF (17)

AA Sequence

MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDE      1 - 70
SSFMNEEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAK     71 - 140
FPIGRRDFDMLRCMLGRVYRPCWQV                                                 141 - 165
//

Text Mined References (60)

PMID Year Title