Property Summary

NCBI Gene PubMed Count 185
PubMed Score 14036.45
PubTator Score 4666.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Globe disease 67 0.0 1.4
colon cancer 1478 0.0 5.87254288692252E-4

Expression

  Differential Expression (20)

Disease log2 FC p
colon cancer -2.000 5.9e-04
Parkinson's disease -1.700 1.9e-02
psoriasis -2.000 3.7e-32
adrenocortical carcinoma -2.044 1.3e-07
adult high grade glioma -3.200 7.9e-03
astrocytoma -3.300 2.7e-15
Astrocytoma, Pilocytic -5.400 1.9e-09
atypical teratoid / rhabdoid tumor -4.200 2.5e-05
Down syndrome -1.200 1.8e-02
ependymoma -4.600 6.5e-04
facioscapulohumeral dystrophy 3.500 1.6e-07
glioblastoma -3.900 1.3e-05
interstitial cystitis -1.900 2.9e-02
intraductal papillary-mucinous adenoma (... -1.100 4.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-02
invasive ductal carcinoma -3.773 4.9e-05
oligodendroglioma -3.300 9.1e-04
Pick disease -1.400 1.9e-02
pituitary cancer -1.300 5.1e-04
sonic hedgehog group medulloblastoma -4.100 6.8e-04

Protein-protein Interaction (1)

Gene RIF (152)

AA Sequence

MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGK      1 - 70
RDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR                71 - 129
//

Text Mined References (187)

PMID Year Title