Property Summary

NCBI Gene PubMed Count 179
Grant Count 1,524
R01 Count 962
Funding $198,459,313.27
PubMed Score 13651.73
PubTator Score 4666.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (82)

Disease Z-score Confidence
Pain agnosia 99 5.758 2.9
Asthma 349 5.333 2.7
Migraine 79 5.192 2.6
Complex regional pain syndrome 12 4.86 2.4
Rhinitis 46 4.784 2.4
Irritable bowel syndrome 59 4.719 2.4
Fibromyalgia 22 4.718 2.4
Dermatitis 107 4.665 2.3
Arthritis 248 4.659 2.3
Constipation 43 4.596 2.3
Neuropathy 210 4.564 2.3
Inflammatory bowel disease 142 4.556 2.3
Cystitis 16 4.454 2.2
Huntington's disease 72 4.332 2.2
Allergic hypersensitivity disease 123 4.314 2.2
Cancer 2,346 4.258 2.1
Pain disorder 13 4.211 2.1
Parkinson's disease 364 4.158 2.1
Keratopathy 12 4.138 2.1
Epicondylitis 19 4.083 2.0
Hypertension 287 3.984 2.0
Diarrhea 155 3.966 2.0
diabetes mellitus 1,663 3.84 1.9
Urticaria 53 3.787 1.9
psoriasis 6,685 3.726 1.9
Pancreatitis 97 3.703 1.9
Sudden infant death syndrome 33 3.659 1.8
Lung disease 132 3.509 1.8
Motion sickness 32 3.506 1.8
Hirschsprung's disease 42 3.499 1.7
Bronchitis 44 3.409 1.7
Alzheimer's disease 644 3.203 1.6
Anxiety disorder 22 3.149 1.6
Cerebrovascular disease 231 3.143 1.6
Schizophrenia 501 3.114 1.6
Angioedema 36 3.1 1.5
Myofascial pain syndrome 7 3.077 1.5
Multiple chemical sensitivity 6 3.073 1.5
Autonomic neuropathy 21 3.072 1.5
Amnesia 17
Arthritis, Experimental 39
Bipolar Disorder 266
Bradycardia 24
Bronchial Hyperreactivity 13
Common Migraine 11
Corneal Diseases 3
Down syndrome 548
Drug Eruptions 18
Drug allergy 36
Edema 38
Extravasation of Diagnostic and Therapeu... 6 
Gastroesophageal reflux disease 37
Globe disease 57 1.0
Hyperalgesia 71
Hyperemia 13
Hypersensitivity 63
Hypotension 53
Inflammation 109
Major Depressive Disorder 106
Narcolepsy 58
Neuralgia 16
Neurogenic Inflammation 12
Pain 70
Pick disease 1,893
Pruritus 6
Sialorrhea 1
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475 1.0
facioscapulohumeral dystrophy 286
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
oligodendroglioma 2,849
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
sonic hedgehog group medulloblastoma 1,482

Expression

  Differential Expression (20)

Synonym

Accession P20366 O60600 O60601 Q00072 Q53GH4 Q549V0 Q549V1 Q549V2 Q6FHM1
Symbols NK2
NPK
NKNA
TAC2
Hs.2563

Gene

PDB

2KS9   2KSA   2KSB   2B19   4HOM  

 GO Function (1)

Gene RIF (146)

PMID Text
26852662 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/beta-arrestin 2/Rho A signaling pathway.
26349209 The spatial structures of human, mouse, and rat hemokinin-1 protein isoforms have been presented.
26038607 Circulating Neurokinin A >/= 50 ng/L is a strong indicator of poor prognosis when Neurokinin A remains above this concentration
25783846 Report absence of full-length neurokinin-1 receptor protein expression by cutaneous T cells in mycosis fungoides and discuss substance P signaling.
25750171 High TAC1 expression is associated with breast cancer.
25690155 findings suggest a proinflammatory role for SP in autoimmune inflammation
25135735 The results showed that the expression of SP and CGRP was significantly enhanced in the neurogenic SMSCs in response to IL-1beta, IL-6 and TNF-alpha, and the effect was remarkably inhibited by HA.
24969128 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease
24908181 Substance P was significantly increased in hypertrophic scars compared with matched unburned skin. In the reticular dermis and papillary dermis, SP represented significant correlation with pain.
24844859 Substance P is upregulated in the serum of patients with chronic spontaneous urticaria
More...

AA Sequence

MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGK      1 - 70
RDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR                71 - 129
//

Text Mined References (181)

PMID Year Title
26852662 2016 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/?-arrestin 2/Rho A signaling pathway.
26349209 [Particularities of Spatial Organization of Human Hemokinin-1 and Mouse/Rat Hemokinin-1 Molecules].
26038607 2016 Raised circulating Neurokinin A predicts prognosis in metastatic small bowel neuroendocrine tumours. Lowering Neurokinin A indicates improved prognosis.
25783846 2015 Absence of full-length neurokinin-1 receptor protein expression by cutaneous T cells: implications for substance P-mediated signaling in mycosis fungoides.
25750171 2015 APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.
25690155 2015 Reciprocal Regulation of Substance P and IL-12/IL-23 and the Associated Cytokines, IFN?/IL-17: A Perspective on the Relevance of This Interaction to Multiple Sclerosis.
25135735 2014 Mutual effect between neuropeptides and inflammatory cytokines in neurogenic SMSCs of human temporomandibular joint.
24969128 2015 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease: a preliminary investigation in the postmortem human brain.
24908181 2014 Immunohistochemical analysis of neuropeptides (protein gene product 9.5, substance P and calcitonin gene-related peptide) in hypertrophic burn scar with pain and itching.
24844859 2014 Substance P is upregulated in the serum of patients with chronic spontaneous urticaria.
More...