Property Summary

NCBI Gene PubMed Count 80
Grant Count 29
R01 Count 19
Funding $2,725,824.2
PubMed Score 131.60
PubTator Score 88.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.137 0.007
lung cancer 1.300 0.002
adult high grade glioma -1.300 0.001
COPD -1.100 0.009
Alzheimer's disease -1.300 0.026
Pick disease -1.600 0.000

Gene RIF (33)

PMID Text
26000619 GORAB missense mutation disrupt RAB6 protein binding in genetic skin diseases.
25962623 several analyses of vesicular transport demonstrated that Rab6A and BICD2 play crucial roles in Golgi tubule fusion with the endoplasmic reticulum (ER) in brefeldin A (BFA)-treated cells
25821985 Rab6A binding to KIF1C's motor domain represents an entirely new mode of regulation for a kinesin motor, and likely has important consequences for KIF1C's cellular functions.
25754817 Data suggest that miR-5100 promotes tumor growth by facilitating the G1/S transition and targeting Rab6.
24006491 Data indicate that myosin Va interacted with multiple new Rab subfamilies including Rab6, Rab14 and Rab39B.
23737971 Mint1 826 bridges APP to the small GTPase
23569112 The presence of an active pool of Rab6 within host cells early during infection is required to support efficient intracellular growth of L. pneumophila.
23091056 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
22750005 the crystal structure of the human Rab6A'(Q72L) mutant form at 1.9A resolution is reported.
22607032 GTP-bound form of Rab6 promotes retrograde trafficking of cav-2 from the Golgi to ER
More...

AA Sequence

MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE     71 - 140
GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC      141 - 208
//

Text Mined References (93)

PMID Year Title
26000619 2015 GORAB Missense Mutations Disrupt RAB6 and ARF5 Binding and Golgi Targeting.
25962623 2015 Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25821985 2015 Rab6 regulation of the kinesin family KIF1C motor domain contributes to Golgi tethering.
25754817 2015 miR-5100 promotes tumor growth in lung cancer by targeting Rab6.
25416956 2014 A proteome-scale map of the human interactome network.
24859005 2014 CLASPs link focal-adhesion-associated microtubule capture to localized exocytosis and adhesion site turnover.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23737971 2013 A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6.
More...