Property Summary

NCBI Gene PubMed Count 80
PubMed Score 131.60
PubTator Score 88.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 7.80796167807085E-6
adult high grade glioma 2148 5.45463335958125E-4
lung cancer 4473 0.00228458714200883
osteosarcoma 7933 0.00718823073252859
COPD 116 0.00891950986445499
Alzheimer's disease 644 0.0259108739878168

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.137 0.007
lung cancer 1.300 0.002
adult high grade glioma -1.300 0.001
COPD -1.100 0.009
Alzheimer's disease -1.300 0.026
Pick disease -1.600 0.000

Synonym

Accession P20340 A8K133 B7Z772 F5H668 Q1W5D8 Q5U0A8 Q9UBE4 Rab-6
Symbols RAB6

Gene

PDB

3BBP   1YZQ   2GIL   3CWZ   4DKX  

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (32)

PMID Text
26000619 GORAB missense mutation disrupt RAB6 protein binding in genetic skin diseases.
25962623 several analyses of vesicular transport demonstrated that Rab6A and BICD2 play crucial roles in Golgi tubule fusion with the endoplasmic reticulum (ER) in brefeldin A (BFA)-treated cells
25821985 Rab6A binding to KIF1C's motor domain represents an entirely new mode of regulation for a kinesin motor, and likely has important consequences for KIF1C's cellular functions.
25754817 Data suggest that miR-5100 promotes tumor growth by facilitating the G1/S transition and targeting Rab6.
24006491 Data indicate that myosin Va interacted with multiple new Rab subfamilies including Rab6, Rab14 and Rab39B.
23737971 Mint1 826 bridges APP to the small GTPase
23569112 The presence of an active pool of Rab6 within host cells early during infection is required to support efficient intracellular growth of L. pneumophila.
23091056 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
22750005 the crystal structure of the human Rab6A'(Q72L) mutant form at 1.9A resolution is reported.
22607032 GTP-bound form of Rab6 promotes retrograde trafficking of cav-2 from the Golgi to ER
More...

AA Sequence

MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA      1 - 70
GQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE     71 - 140
GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC      141 - 208
//

Text Mined References (93)

PMID Year Title
26000619 2015 GORAB Missense Mutations Disrupt RAB6 and ARF5 Binding and Golgi Targeting.
25962623 2015 Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25821985 2015 Rab6 regulation of the kinesin family KIF1C motor domain contributes to Golgi tethering.
25754817 2015 miR-5100 promotes tumor growth in lung cancer by targeting Rab6.
25416956 2014 A proteome-scale map of the human interactome network.
24859005 2014 CLASPs link focal-adhesion-associated microtubule capture to localized exocytosis and adhesion site turnover.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23737971 2013 A new Mint1 isoform, but not the conventional Mint1, interacts with the small GTPase Rab6.
More...