Property Summary

NCBI Gene PubMed Count 160
Grant Count 242
R01 Count 154
Funding $19,517,360.69
PubMed Score 565.40
PubTator Score 389.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P20339 B4DJA5 Q6FI44
Symbols RAB5

Gene

PDB

4Q9U   3MJH   1TU3   1N6H   1N6I   1N6K   1N6L   1N6N   1N6O   1N6P   1N6R   1R2Q   1TU4  

Gene RIF (101)

PMID Text
26680696 PLD1 recovers the decrease in epidermal growth factor receptor (EGFR) endocytosis induced by HIF-1alpha independent of lipase activity via the Rab5-mediated endosome fusion pathway.
26528697 Findings indicate the role of CMTM7 protein in the regulation of epidermal growth factor receptor (EGFR)-AKT proto-oncogene protein signaling in tumor cells, and as a molecule related to Rab5 GTP-binding protein activation.
26473288 Low expression of RAB5A is associated with metastasis in prostate cancer.
26344766 Data show that Rab22a- and Rab5a-driven phagosomal uptake is a crucial step in the vesicular cascade that leads to elimination of spirochetes by macrophages.
26261586 Higher expression of Rab5A was observed in colorectal cancer tissues and Rab5A may be identified as a useful predictor of metastasis and prognosis for CRC.
26195760 Membrane attack complexes activate noncanonical NF-kappaB by forming a novel Akt(+)NIK(+) signalosome on Rab5(+) endosomes.
26181205 Prelamin A/C was translocated to the nuclear membrane and formed a proper nuclear envelope. Rab5a was translocated to the early endosomes. The specific localizations of the prenylated proteins were dependent on intracellular oxygen concentration
26168723 findings suggest that Rab5 expression is required to maintain characteristics associated with cell transformation
26112597 Rab5a is a key mediator of LPS-induced vascular hyperpermeability.
26061722 HIV-1 Nef-HLA-A (MHCI) interaction localizes with RAB5A-positive early endosomes
More...

AA Sequence

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK      1 - 70
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK     71 - 140
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN    141 - 210
QCCSN                                                                     211 - 215
//

Text Mined References (169)

PMID Year Title
26680696 2015 The pleckstrin homology domain of phospholipase D1 accelerates EGFR endocytosis by increasing the expression of the Rab5 effector, rabaptin-5.
26528697 2015 CMTM7 knockdown increases tumorigenicity of human non-small cell lung cancer cells and EGFR-AKT signaling by reducing Rab5 activation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26473288 2015 Endosomal gene expression: a new indicator for prostate cancer patient prognosis?
26344766 2015 ER-Coordinated Activities of Rab22a and Rab5a Drive Phagosomal Compaction and Intracellular Processing of Borrelia burgdorferi by Macrophages.
26261586 2015 Increased expression of Rab5A predicts metastasis and poor prognosis in colorectal cancer patients.
26195760 2015 Complement membrane attack complexes activate noncanonical NF-?B by forming an Akt+ NIK+ signalosome on Rab5+ endosomes.
26181205 2015 Intracellular oxygen determined by respiration regulates localization of Ras and prenylated proteins.
26168723 2015 Down-regulation of Rab5 decreases characteristics associated with maintenance of cell transformation.
26112597 2015 Rab5-mediated VE-cadherin internalization regulates the barrier function of the lung microvascular endothelium.
More...