Property Summary

NCBI Gene PubMed Count 177
PubMed Score 602.12
PubTator Score 389.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.145 4.3e-02
Astrocytoma, Pilocytic 1.200 1.5e-02
Gaucher disease type 1 -1.200 3.9e-02
intraductal papillary-mucinous adenoma (... 1.300 1.8e-02
medulloblastoma, large-cell -1.100 4.4e-04
osteosarcoma 1.596 3.4e-04
psoriasis 2.000 4.2e-06
subependymal giant cell astrocytoma -1.681 4.6e-02

Protein-protein Interaction (9)

Gene RIF (116)

AA Sequence

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK      1 - 70
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK     71 - 140
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN    141 - 210
QCCSN                                                                     211 - 215
//

Text Mined References (186)

PMID Year Title