Property Summary

NCBI Gene PubMed Count 69
Grant Count 109
R01 Count 67
Funding $7,622,954.13
PubMed Score 144.82
PubTator Score 98.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.425 0.001
malignant mesothelioma -4.400 0.000
hereditary spastic paraplegia -1.075 0.006
pancreatic ductal adenocarcinoma liver m... -1.408 0.020
lung cancer 1.100 0.001
breast carcinoma 1.200 0.009
non primary Sjogren syndrome sicca 1.300 0.042
lung adenocarcinoma 1.376 0.000
gastric carcinoma -1.100 0.007
dermatomyositis -1.200 0.019

Synonym

Accession P20338 Q5T7P7 Q9BQ44
Symbols RAB4
HRES1
HRES-1
HRES-1/RAB4

Gene

PDB

1Z0K   1YU9   2BMD   2BME  

Gene RIF (30)

PMID Text
26716952 Rab4 expression is up-regulated by laminar shear stress, which contributed to improved vascular endothelial cell autophagy and function.
26430212 The results contradict the model of feedback activation of Rab5 and instead indicate that Rbpt5 is recruited by both Rabex5 recognizing ubiquitylated cargo and by Rab4 to activate Rab5 in a feed-forward manner.
24835460 Together the findings indicate that Arl1 links Rab4-dependent formation of endosomal sorting domains with downstream assembly of adaptor protein complexes that constitute the endosomal sorting machinery.
24404161 HRES-1/Rab4 regulates autophagy through promoting the formation of LC3(+) autophagosomes and the preservation of mitochondria.
23792956 Data indicate that Rab4 regulates ether-a-go-go-related gene (hERG) channel density via neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2).
23019362 TBC1D16 is a GTPase activating protein for Rab4A that regulates transferrin receptor recycling and EGFR trafficking and signaling.
22825871 our findings suggest an evolutionarily conserved function of HDPTP-Rab4 in the regulation of endocytic trafficking, cell adhesion and migration.
21669283 Upregulated expression of rab4, rab5, rab7 and rab27 correlates with antemortem measures of cognitive decline in individuals with mild cognitive impairment and Alzheimer disease.
21501115 Thus down- or up-regulation of Rab4A expression or Rab4A function triggered inhibition or increase of procathepsin L secretion respectively.
20943774 Overexpression of Rab4 regulates angiotensin II type I receptor phosphorylation and sensitization.
More...

AA Sequence

MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTA      1 - 70
GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE     71 - 140
ASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQA    141 - 210
PNAQECGC                                                                  211 - 218
//

Text Mined References (73)

PMID Year Title
26716952 2016 Laminar Shear Stress Promotes Vascular Endothelial Cell Autophagy Through Upregulation with Rab4.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26430212 2015 Rabaptin5 is recruited to endosomes by Rab4 and Rabex5 to regulate endosome maturation.
25416956 2014 A proteome-scale map of the human interactome network.
24835460 2014 Rab4 orchestrates a small GTPase cascade for recruitment of adaptor proteins to early endosomes.
24404161 2014 HRES-1/Rab4 promotes the formation of LC3(+) autophagosomes and the accumulation of mitochondria during autophagy.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23792956 2013 Regulation of the human ether-a-go-go-related gene (hERG) channel by Rab4 protein through neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23019362 2012 TBC1D16 is a Rab4A GTPase activating protein that regulates receptor recycling and EGF receptor signaling.
More...