Property Summary

NCBI Gene PubMed Count 70
PubMed Score 148.74
PubTator Score 98.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma 1.200 8.7e-03
dermatomyositis -1.200 1.9e-02
gastric carcinoma -1.100 6.6e-03
hereditary spastic paraplegia -1.075 6.4e-03
lung adenocarcinoma 1.376 1.2e-05
lung cancer 1.100 5.9e-04
malignant mesothelioma -4.300 9.6e-10
Multiple myeloma 1.425 1.3e-03
non primary Sjogren syndrome sicca 1.300 4.2e-02
pancreatic ductal adenocarcinoma liver m... -1.408 2.0e-02

Gene RIF (31)

AA Sequence

MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTA      1 - 70
GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE     71 - 140
ASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQA    141 - 210
PNAQECGC                                                                  211 - 218
//

Text Mined References (75)

PMID Year Title