Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.82
PubTator Score 18.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 7.3e-03
Alzheimer's disease -1.500 3.2e-02
astrocytic glioma -1.900 2.3e-03
Astrocytoma, Pilocytic -1.600 4.5e-04
atypical teratoid / rhabdoid tumor -1.600 7.8e-03
ependymoma -1.200 7.5e-03
glioblastoma -1.300 1.9e-04
group 3 medulloblastoma -1.600 2.9e-02
head and neck cancer and chronic obstruc... -1.300 9.6e-03
lung carcinoma 2.100 5.6e-11
malignant mesothelioma -1.100 1.0e-04
medulloblastoma, large-cell -1.600 2.7e-02
oligodendroglioma -2.400 5.3e-04
Pick disease -1.800 1.1e-03
pituitary cancer 1.200 8.7e-03
psoriasis -2.900 4.2e-115
subependymal giant cell astrocytoma -1.630 1.2e-02

Gene RIF (6)

AA Sequence

MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKR      1 - 70
VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDME     71 - 140
EERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTP    141 - 210
PLLQQNCSC                                                                 211 - 219
//

Text Mined References (28)

PMID Year Title