Property Summary

NCBI Gene PubMed Count 26
Grant Count 8
R01 Count 5
Funding $339,699.42
PubMed Score 26.81
PubTator Score 18.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma -1.900 0.002
ependymoma -3.200 0.000
oligodendroglioma -2.400 0.001
glioblastoma -2.200 0.000
group 3 medulloblastoma -2.800 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.600 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -2.600 0.000
subependymal giant cell astrocytoma -1.630 0.012
lung carcinoma 2.100 0.000
Alzheimer's disease -1.500 0.032
Pick disease -1.800 0.001
pituitary cancer 1.200 0.009
head and neck cancer and chronic obstruc... -1.300 0.010
psoriasis -2.900 0.000

Gene RIF (5)

PMID Text
22321395 The structure of Rab3B:GDP complex was solved to 1.9A resolution and the structural base comparison with other Rab3 members provides a structural basis for the GDP/GTP switch in controlling the activity of small GTPase.
20807725 These results support an important inter-species difference in regulating insulin exocytosis where RAB3B is the most expressed isoform in human islets.
20007772 RAB3B improves dopamine handling and storage capacity at presynaptic terminals, and confers protection to vulnerable DA neurons.
19717423 Rab3b/3c-positive recycling vesicles are involved in and may constitute one of the recycling compartments in exogenous antigen cross-presentation.
19384079 these results add new information to the view that Rab3B is involved in the regulation of pituitary hormone secretion.

AA Sequence

MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKR      1 - 70
VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDME     71 - 140
EERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTP    141 - 210
PLLQQNCSC                                                                 211 - 219
//

Text Mined References (27)

PMID Year Title
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22321395 2012 Crystal structure of inactive form of Rab3B.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20807725 2010 In vitro expression of NGN3 identifies RAB3B as the predominant Ras-associated GTP-binding protein 3 family member in human islets.
20007772 2009 Functional enhancement and protection of dopaminergic terminals by RAB3B overexpression.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19384079 2009 Rab3B immunoexpression in human pituitary adenomas.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...