Property Summary

NCBI Gene PubMed Count 59
Grant Count 90
R01 Count 57
Funding $9,122,037.62
PubMed Score 203.15
PubTator Score 119.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -3.200 0.000
malignant mesothelioma -2.700 0.000
astrocytoma -2.300 0.000
oligodendroglioma -2.300 0.000
psoriasis -2.200 0.000
glioblastoma multiforme -2.600 0.000
sonic hedgehog group medulloblastoma -2.000 0.000
atypical teratoid/rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -1.100 0.002
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -2.700 0.000
lung carcinoma 2.300 0.000

Synonym

Accession P20336 A8K0J4 Q9NYE1
Symbols

Gene

Gene RIF (16)

PMID Text
25713146 Data indicate that exocytic stimuli promote ADP ribosylation factor 6 (ARF6) activation, which accomplishes exocytosis by stimulating Rab3A GTP-Binding Protein.
25613138 The gene expression of RAB3A is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24965146 Rab3a accelerates cell proliferation by increasing cyclin D1 expression, enhances anti-cancer drug resistance, and increases tumorigenicity and self-renewal of glioma cells.
24652202 Five compounds which possess good inhibitory activity and may act as potential high affinity inhibitors against Rab3A active site were identified
23344955 alpha-Synuclein membrane association is regulated by the Rab3a recycling machinery and presynaptic activity
22753498 Rab27 and Rab3 sequentially regulate human sperm dense-core granule exocytosis.
21349835 Myo5a and Rab3A are direct binding partners and interact on synaptic vesicles and the Myo5a/Rab3A complex is involved in transport of neuronal vesicles
19923287 The maturation of amyloid precursor protein (APP) transport vesicles, including recruitment of conventional kinesin, requires Rab3A GTPase activity.
19546222 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis
18559336 Rab3GEP has a role as the non-redundant guanine nucleotide exchange factor for Rab27a in melanocytes
More...

AA Sequence

MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR      1 - 70
IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME     71 - 140
DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ    141 - 210
QVPPHQDCAC                                                                211 - 220
//

Text Mined References (60)

PMID Year Title
25713146 2015 ADP ribosylation factor 6 (ARF6) promotes acrosomal exocytosis by modulating lipid turnover and Rab3A activation.
25416956 2014 A proteome-scale map of the human interactome network.
24965146 2014 Rab3a promotes brain tumor initiation and progression.
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24652202 2014 3D structure generation, virtual screening and docking of human Ras-associated binding (Rab3A) protein involved in tumourigenesis.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23344955 2013 ?-Synuclein membrane association is regulated by the Rab3a recycling machinery and presynaptic activity.
22899725 2012 A complete Rab screening reveals novel insights in Weibel-Palade body exocytosis.
22753498 2012 Rab27 and Rab3 sequentially regulate human sperm dense-core granule exocytosis.
More...