Property Summary

NCBI Gene PubMed Count 60
PubMed Score 206.64
PubTator Score 119.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.900 1.8e-03
adult high grade glioma -2.500 7.6e-05
astrocytic glioma -1.900 2.0e-03
Astrocytoma, Pilocytic -2.800 1.9e-09
atypical teratoid / rhabdoid tumor -2.400 9.6e-09
glioblastoma -2.600 1.3e-10
group 3 medulloblastoma -1.400 2.1e-02
lung carcinoma 2.300 1.1e-44
malignant mesothelioma -2.700 2.0e-06
medulloblastoma, large-cell -1.100 1.9e-03
oligodendroglioma -1.400 1.8e-02
psoriasis -2.200 4.7e-05

Protein-protein Interaction (12)

Gene RIF (17)

AA Sequence

MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR      1 - 70
IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME     71 - 140
DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ    141 - 210
QVPPHQDCAC                                                                211 - 220
//

Text Mined References (61)

PMID Year Title