Property Summary

NCBI Gene PubMed Count 411
PubMed Score 4484.73
PubTator Score 761.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Narcolepsy 72 0.0 5.0

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 1.2e-03
gastric carcinoma 1.300 3.4e-02
group 4 medulloblastoma -1.500 4.2e-04
interstitial cystitis 1.600 2.1e-03
lung adenocarcinoma -1.398 2.6e-05
lung cancer -1.300 5.0e-03
lung carcinoma -1.100 9.6e-08
medulloblastoma, large-cell -1.700 1.1e-06
osteosarcoma -2.963 2.8e-05
ovarian cancer -1.100 1.7e-03
primary Sjogren syndrome 1.300 3.2e-03
subependymal giant cell astrocytoma 1.919 2.9e-03
ulcerative colitis 1.200 1.6e-04

Gene RIF (408)

AA Sequence

MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKT      1 - 70
SDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPL     71 - 140
RKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMA    141 - 210
PGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVN    211 - 280
CVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQA    281 - 350
PGVEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ    351 - 420
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS                                 421 - 461
//

Text Mined References (414)

PMID Year Title