Property Summary

NCBI Gene PubMed Count 392
Grant Count 495
R01 Count 276
Funding $55,661,670.94
PubMed Score 4164.46
PubTator Score 761.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 0.001
osteosarcoma -2.963 0.000
medulloblastoma, large-cell -1.700 0.000
lung cancer -1.700 0.000
interstitial cystitis 1.600 0.002
group 4 medulloblastoma -1.500 0.000
primary Sjogren syndrome 1.300 0.003
subependymal giant cell astrocytoma 1.919 0.003
lung adenocarcinoma -1.398 0.000
lung carcinoma -1.300 0.000
gastric carcinoma 1.300 0.034
ulcerative colitis 1.200 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P20333 B1AJZ3 Q16042 Q6YI29 Q9UIH1
Symbols p75
TBPII
TNFBR
TNFR2
CD120b
TNFR1B
TNFR80
TNF-R75
p75TNFR
TNF-R-II

Gene

PDB

3ALQ   1CA9  

Gene RIF (389)

PMID Text
26928194 Higher circulating sTNFR1 and sTNFR2 are associated with diabetic kidney disease, and predicts incident cardiovascular disease and mortality independently of microalbuminuria and kidney function in type 2 diabetics.
26574625 Atorvastatin reduced soluble TNFR1/2 receptors in systemic lupus erythematosus.
26569118 NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid
26492598 TNF-alpha/TNFR2 regulatory axis stimulates EphB2-mediated neuroregeneration via activation of NF-kappaB.
26483205 our findings implicate TNFR2 in supporting myeloid-derived suppressor cells -mediated immune suppression and metastasis in the liver
26476273 that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration
26425877 Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury.
26280204 study suggests that TNFR2(+) Tregs play a role in promoting tumor progressive metastasis
26258847 Recurrent point mutations and genomic gains of TNFRSF1B, encoding the tumor necrosis factor receptor TNFR2, are present in a subset of patients with mycosis fungoides and Sezary syndrome.
26177311 TNFR1 and TNFR2 were significant predictors of disease progression in IgA nephropathy.
More...

AA Sequence

MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKT      1 - 70
SDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPL     71 - 140
RKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMA    141 - 210
PGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVN    211 - 280
CVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQA    281 - 350
PGVEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ    351 - 420
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS                                 421 - 461
//

Text Mined References (395)

PMID Year Title
26928194 2016 Association of soluble tumor necrosis factor receptors 1 and 2 with nephropathy, cardiovascular events, and total mortality in type 2 diabetes.
26574625 Atorvastatin reduced soluble receptors of TNF-alpha in systemic lupus erythematosus.
26569118 2015 NGF Modulates trkANGFR/p75NTR in ?SMA-Expressing Conjunctival Fibroblasts from Human Ocular Cicatricial Pemphigoid (OCP).
26492598 2016 TNF-?/TNFR2 Regulatory Axis Stimulates EphB2-Mediated Neuroregeneration Via Activation of NF-?B.
26483205 2015 TNF Receptor-2 Facilitates an Immunosuppressive Microenvironment in the Liver to Promote the Colonization and Growth of Hepatic Metastases.
26476273 2015 Gamma-secretase-independent role for cadherin-11 in neurotrophin receptor p75 (p75(NTR)) mediated glioblastoma cell migration.
26425877 2016 Pretransplant Recipient Circulating CD4+CD127lo/- Tumor Necrosis Factor Receptor 2+ Regulatory T Cells: A Surrogate of Regulatory T Cell-Suppressive Function and Predictor of Delayed and Slow Graft Function After Kidney Transplantation.
26280204 2015 Expression of TNFR2 by regulatory T cells in peripheral blood is correlated with clinical pathology of lung cancer patients.
26258847 2015 Genomic analysis of mycosis fungoides and Sézary syndrome identifies recurrent alterations in TNFR2.
26177311 2015 Circulating Tumor Necrosis Factor ? Receptors Predict the Outcomes of Human IgA Nephropathy: A Prospective Cohort Study.
More...