Property Summary

Ligand Count 969
NCBI Gene PubMed Count 156
PubMed Score 447.94
PubTator Score 425.83

Knowledge Summary

Patent (11,135)


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 3.0


  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.517 1.4e-02
active ulcerative colitis 1.053 3.0e-02
adult high grade glioma -2.600 2.5e-02
astrocytic glioma -1.200 1.5e-02
atypical teratoid / rhabdoid tumor -2.000 1.3e-03
chronic rhinosinusitis 1.078 5.0e-02
cystic fibrosis -1.200 7.1e-05
ependymoma -1.400 9.9e-03
glioblastoma -1.200 2.1e-02
group 4 medulloblastoma 3.400 5.4e-03
intraductal papillary-mucinous neoplasm ... -2.000 1.5e-02
lung adenocarcinoma -1.100 6.4e-05
oligodendroglioma -1.100 4.4e-02
osteosarcoma -1.728 2.2e-02
ovarian cancer -1.400 2.0e-02
pancreatic cancer -1.700 2.1e-03
Parkinson's disease -1.100 1.2e-02
Pick disease -1.500 4.7e-02
primary pancreatic ductal adenocarcinoma -1.753 1.8e-03
psoriasis -1.500 1.2e-03

Gene RIF (121)

AA Sequence

CQCDKKKRRKQQYQQRQSVIFHKRAPEQAL                                            561 - 590

Text Mined References (158)

PMID Year Title