Property Summary

NCBI Gene PubMed Count 131
Grant Count 65
R01 Count 37
Funding $4,657,332.49
PubMed Score 446.81
PubTator Score 1440.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P20292 Q5VV04
Symbols FLAP

Gene

PANTHER Protein Class (1)

PDB

2Q7M   2Q7R  

Gene RIF (131)

PMID Text
26327594 THE 5-LOX interface involving the four cysteines 159, 300, 416 and 418 is important for the translocation to the nuclear membrane and the colocalization with FLAP.
26289316 findings show that several enzymes known to be involved in the biosynthesis of proinflammatory LTs, such as FLAP and cPLA2alpha, also contribute to LX and Rv formation
26159646 The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility
25862617 Genetic interaction of CD80 and ALOX5AP was observed in systemic lupus erythematosus in Asian populations.
25815512 Our study provides evidence that the promoter single nucleotide polymorphism (SNP) rs17222919 of the ALOX5AP is a potential genetic protective factor for IS in the Chinese Han population.
25721704 Report no association between ALOX5AP SNPs and atherosclerotic plaque phenotypes.
25534367 Genetic polymorphisms of ALOX5AP and CYP3A5 increase susceptibility to ischemic stroke and are associated with atherothrombotic events in stroke patients.
25242267 results of the meta-analysis indicate that ALOX5AP rs10507391/SG13S114 A>T polymorphism is not associated with the risk of cerebral infarction in the Chinese population.
25210744 Rs10507391, rs4769874 and its haplotypes in ALOX5AP are unrelated to ACS risk in the Chinese Han population of Changwu, but elevated serum LTB4 level is strongly associated withacute coronary syndrome risk
25034252 The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied.
More...

AA Sequence

MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV      1 - 70
LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG     71 - 140
SDFENYIKTISTTISPLLLIP                                                     141 - 161
//

Text Mined References (133)

PMID Year Title
26327594 2015 Characterization of the interaction of human 5-lipoxygenase with its activating protein FLAP.
26289316 2015 Lipoxin and resolvin biosynthesis is dependent on 5-lipoxygenase activating protein.
26159646 2015 Variants in the Atherogenic ALOX5AP, THBD, and KNG1 Genes Potentiate the Risk of Ischemic Stroke via a Genetic Main Effect and Epistatic Interactions in a Chinese Population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862617 2016 Genome-wide search followed by replication reveals genetic interaction of CD80 and ALOX5AP associated with systemic lupus erythematosus in Asian populations.
25815512 2015 A promoter polymorphism (rs17222919, -1316T/G) of ALOX5AP gene is associated with decreased risk of ischemic stroke in two independent Chinese populations.
25721704 2015 Variants in ALOX5, ALOX5AP and LTA4H are not associated with atherosclerotic plaque phenotypes: the Athero-Express Genomics Study.
25534367 2015 Genetic polymorphisms of ALOX5AP and CYP3A5 increase susceptibility to ischemic stroke and are associated with atherothrombotic events in stroke patients.
25242267 2015 Association of ALOX5AP rs10507391/SG13S114 A>T polymorphism with cerebral infarction in the Chinese population: a meta-analysis study.
25210744 2014 Interrelationships between ALOX5AP polymorphisms, serum leukotriene B4 level and risk of acute coronary syndrome.
More...