Property Summary

Ligand Count 1,860
NCBI Gene PubMed Count 137
PubMed Score 446.80
PubTator Score 1440.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease -1.110 1.8e-02
adrenocortical carcinoma -1.825 4.6e-03
adult high grade glioma 1.400 1.4e-02
Astrocytoma, Pilocytic 2.000 5.7e-09
cutaneous lupus erythematosus 1.200 2.5e-02
Down syndrome 1.100 3.3e-02
ependymoma 1.100 2.0e-03
glioblastoma 1.500 2.0e-03
group 3 medulloblastoma -1.600 5.1e-04
interstitial cystitis 1.700 2.0e-03
intraductal papillary-mucinous carcinoma... -1.100 1.6e-03
invasive ductal carcinoma 1.376 6.8e-03
lung adenocarcinoma -2.200 5.8e-10
lung cancer -3.500 5.1e-05
lung carcinoma -4.300 7.7e-39
malignant mesothelioma -3.000 2.1e-08
medulloblastoma, large-cell -1.300 7.0e-04
non-small cell lung cancer -2.150 1.6e-16
pancreatic cancer 1.200 6.9e-03
primary pancreatic ductal adenocarcinoma 1.360 1.1e-02
primary Sjogren syndrome 1.100 1.3e-02
sarcoidosis -1.100 2.9e-02
tuberculosis and treatment for 3 months -1.200 3.4e-05
ulcerative colitis 1.500 7.8e-04

Protein-protein Interaction (1)

Gene RIF (137)

AA Sequence

MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV      1 - 70
LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG     71 - 140
SDFENYIKTISTTISPLLLIP                                                     141 - 161
//

Text Mined References (139)

PMID Year Title