Property Summary

NCBI Gene PubMed Count 18
PubMed Score 106.59
PubTator Score 41.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 5.2e-04
inflammatory breast cancer -1.200 9.2e-03
medulloblastoma, large-cell 1.300 6.7e-05
Multiple myeloma 1.912 6.7e-06
ovarian cancer -2.400 6.2e-09
Waldenstrons macroglobulinemia 1.489 2.0e-03

Gene RIF (9)

AA Sequence

MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTA      1 - 70
RRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAET     71 - 140
KQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN        141 - 206
//

Text Mined References (27)

PMID Year Title