Property Summary

NCBI Gene PubMed Count 18
Grant Count 12
R01 Count 10
Funding $868,258.67
PubMed Score 100.45
PubTator Score 41.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (9)

PMID Text
24386364 BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue
23901224 BTF3 expression is associated with enhanced cell proliferation, reduced cell cycle regulation and apoptosis and its silencing decreased colony forming and proliferation of gastric cancer cells.
23532689 BTF3 overexpression may be an early event in colorectal cancer development and could be useful biomarker for the early stage of colorectal cancers (CRC); BTF3 has positive correlations with NF-kappaB, RAD50, MRE11, NBS1 and AEG-1 and might influence complex signal pathways in CRC
23363935 may have a functional role in protecting against caries
20016921 Using acetylated HIV-1 IN as bait in yeast two-hybrid screening identifies transcription regulatory and chromatin remodeling factors LEDGF/p75, KAP1, BTF3b, THRAP3, and HMGN2 as IN-binding partners
19460752 Knockdown of basic transcription factor 3 (BTF3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18025262 BTF3 interacts with ERalpha that has been activated either by 17beta-estradiol (ligand-dependent activation) or by epidermal growth factor (ligand-independent activation).
17312387 BTF3 is overexpressed in pancreatic ductal adenocarcinoma , where it acts as a transcriptional regulator rather than a direct modulator of apoptosis.
2320128 In addition to RNA polymerase II (otherwise RNA pol II, RNA polymerase B), four general transcription factors are required for initiation of transcription: BTF1 (also referred to as TFIID) which has recently been cloned from yeast, BTF2, BTF3 and STF.

AA Sequence

MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTA      1 - 70
RRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAET     71 - 140
KQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN        141 - 206
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24386364 2013 Quantitative analysis of BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23901224 2013 Basic transcription factor 3 is involved in gastric cancer development and progression.
23532689 2013 Clinicopathological significance of BTF3 expression in colorectal cancer.
23363935 2013 Fine-mapping of 5q12.1-13.3 unveils new genetic contributors to caries.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...