Property Summary

NCBI Gene PubMed Count 64
Grant Count 271
R01 Count 121
Funding $63,512,872.68
PubMed Score 798.66
PubTator Score 540.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -1.200 0.004
cutaneous lupus erythematosus 2.400 0.020
psoriasis 1.100 0.001
osteosarcoma -2.953 0.000
group 4 medulloblastoma -1.300 0.004
interstitial cystitis 1.600 0.011
adult high grade glioma -1.200 0.010
posterior fossa group B ependymoma -1.200 0.000
primary Sjogren syndrome 1.200 0.000
nasopharyngeal carcinoma -1.400 0.000
Pick disease -1.500 0.000
progressive supranuclear palsy -1.300 0.010

Gene

 GO Function (1)

 GO Process (1)

Gene RIF (36)

PMID Text
26507663 results demonstrate that loss of high affinity CD22 ligands on GC B-cells occurs in both mice and humans through alternative mechanisms, unmasking CD22 relative to naive and memory B-cells
26379425 Anti-CD22-magnetic nanoparticles-doxorubicin inhibited the proliferation of Raji cells, significantly increased the uptake of doxorubicin, and induced apoptosis.
26017478 MicroRNA-19a and CD22 Comprise a Feedback Loop for B Cell Response in Sepsis.
25484043 These results suggest that the in vivo mechanism of non-ligand-blocking epratuzumab may, in part, involve the unmasking of CD22 to facilitate the trans-interaction of B cells with vascular endothelium.
25182044 By using integrative genomics and analysing the relationships of COPD phenotypes with SNPs and gene expression in lung tissue, we identified CST3 and CD22 as potential causal genes for airflow obstruction.
23184497 study detected the expression of CD22 and CD72 on B cells of myasthenia gravis, compared to multiple sclerosis patient controls and healthy controls y
23083346 In the absence of functional CD22, B cells have a "hyperactivated" phenotype, CD22 dysfunction could contribute to the pathogenesis of autoimmune diseases. (Review)
22986740 The finding that CD22 is expressed on lung cancer cells is significant in revealing a heretofore unknown mechanism of tumorigenesis and metastasis
22355053 Anti-CD22 recombinant immunotoxin moxetumomab pasudotox has activity in relapsed/refractory hairy cell leukemia.
22017452 Our study implicates the CD22DeltaE12 genetic defect in the aggressive biology of relapsed or therapy-refractory paediatric B-lineage ALL.
More...

AA Sequence

MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSK      1 - 70
FDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERP     71 - 140
FPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQW    141 - 210
SHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWL    211 - 280
KDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVE    281 - 350
FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK    351 - 420
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSW    421 - 490
CSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDS    491 - 560
ISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWF    561 - 630
DWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILI    631 - 700
LAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEM    701 - 770
NIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV    771 - 840
DYVILKH                                                                   841 - 847
//

Text Mined References (66)

PMID Year Title
26507663 2015 Unmasking of CD22 Co-receptor on Germinal Center B-cells Occurs by Alternative Mechanisms in Mouse and Man.
26379425 2015 Novel synthesizing method of pH-dependent doxorubicin-loaded anti-CD22-labelled drug delivery nanosystem.
26017478 2015 MicroRNA-19a and CD22 Comprise a Feedback Loop for B Cell Response in Sepsis.
25484043 2015 Extensive crosslinking of CD22 by epratuzumab triggers BCR signaling and caspase-dependent apoptosis in human lymphoma cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25182044 2014 Genetic regulation of gene expression in the lung identifies CST3 and CD22 as potential causal genes for airflow obstruction.
23184497 2013 Modulation of B cell regulatory molecules CD22 and CD72 in myasthenia gravis and multiple sclerosis.
23083346 2012 CD22 and autoimmune disease.
22986740 2012 CD22 antigen is broadly expressed on lung cancer cells and is a target for antibody-based therapy.
22355053 2012 Phase I trial of anti-CD22 recombinant immunotoxin moxetumomab pasudotox (CAT-8015 or HA22) in patients with hairy cell leukemia.
More...