Property Summary

Ligand Count 7
NCBI Gene PubMed Count 69
PubMed Score 829.04
PubTator Score 540.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 9.6e-03
Chronic Lymphocytic Leukemia -1.197 3.8e-03
cutaneous lupus erythematosus 1.900 2.6e-02
group 4 medulloblastoma -1.300 4.1e-03
interstitial cystitis 1.600 1.1e-02
nasopharyngeal carcinoma -1.400 2.7e-04
osteosarcoma -2.607 4.0e-08
Pick disease -1.500 1.6e-04
posterior fossa group A ependymoma -1.100 5.0e-07
primary Sjogren syndrome 1.200 2.2e-04
progressive supranuclear palsy -1.300 1.0e-02
psoriasis 1.100 6.1e-04

Protein-protein Interaction (2)

Gene RIF (41)

AA Sequence

MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSK      1 - 70
FDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERP     71 - 140
FPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQW    141 - 210
SHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWL    211 - 280
KDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVE    281 - 350
FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK    351 - 420
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSW    421 - 490
CSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDS    491 - 560
ISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWF    561 - 630
DWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILI    631 - 700
LAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEM    701 - 770
NIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV    771 - 840
DYVILKH                                                                   841 - 847
//

Text Mined References (71)

PMID Year Title