Property Summary

NCBI Gene PubMed Count 38
Grant Count 11
R01 Count 5
Funding $591,503.79
PubMed Score 111.33
PubTator Score 151.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 0.000
glioblastoma multiforme 1.200 0.000
oligodendroglioma 1.100 0.000
primitive neuroectodermal tumor 1.200 0.016
pediatric high grade glioma 1.100 0.001
group 4 medulloblastoma -3.400 0.000
psoriasis -1.100 0.000

Gene RIF (15)

PMID Text
26833329 We show that POU3F2 lies downstreamof SIM1 and controls oxytocin expression in the hypothalamic neuroendocrine preoptic area. We show that this finding is consistent with the expression patterns of POU3F2 and related genes in the human brain.
23530560 BRN2 is a higher level regulator than ASCL1 and ND1 and BRN2 might be involved in aggressiveness of small cell lung cancer.
23358112 TTF1 expression in small-cell lung cancer is a cell lineage-specific phenomenon that involves the developing neural cell-specific homeoprotein BRN2.
23069940 The present study investigated transcriptional regulation of CDH13 in melanoma. Found an inverse correlation between BRN2 and T-cadherin protein and transcript expression in melanoma.
22988297 PI3K has a crucial role in regulating Brn-2 and Pax3 expression and neoplasm invasiveness, and it is a key determinant of melanoma subpopulation diversity.
21435193 a model for the apparent non-overlapping expression levels of BRN2 and MITF in melanoma, mediated by miR-211 expression.
21358674 links BRN2 as an activator and MITF as a repressor of the NOTCH pathway in melanoma cells. Loss of the BRN2-MITF axis in antisense-ablated cell lines decreased the melanoma sphere-forming capability and cell adhesion
20337985 POU3F2 may regulate the properties of melanoma cells via autocrine KIT ligand signalling.
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18996486 Expression and purification of full-length BRN2, a transcription factor involved in melanoma growth, are reported.
More...

AA Sequence

MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGG      1 - 70
GGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQ     71 - 140
QQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGL    141 - 210
HHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQR    211 - 280
RIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAA    281 - 350
QGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP    351 - 420
GAEDVYGGSRDTPPHHGVQTPVQ                                                   421 - 443
//

Text Mined References (41)

PMID Year Title
26833329 2016 Small 6q16.1 Deletions Encompassing POU3F2 Cause Susceptibility to Obesity and Variable Developmental Delay with Intellectual Disability.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24618891 2014 Genome-wide association study reveals two new risk loci for bipolar disorder.
23530560 2013 POU domain transcription factor BRN2 is crucial for expression of ASCL1, ND1 and neuroendocrine marker molecules and cell growth in small cell lung cancer.
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
23358112 2013 Neural lineage-specific homeoprotein BRN2 is directly involved in TTF1 expression in small-cell lung cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23069940 2012 BRN2 is a transcriptional repressor of CDH13 (T-cadherin) in melanoma cells.
22988297 2012 A phosphatidylinositol 3-kinase-Pax3 axis regulates Brn-2 expression in melanoma.
More...