Property Summary

NCBI Gene PubMed Count 41
PubMed Score 119.73
PubTator Score 151.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Bipolar Disorder 666
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Melanoma 711 4.161 2.1
Embryonal carcinoma 10 3.559 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 4.5e-13
glioblastoma multiforme 1.200 4.9e-13
group 3 medulloblastoma -1.900 5.3e-03
oligodendroglioma 1.100 5.6e-09
pediatric high grade glioma 1.100 6.5e-04
primitive neuroectodermal tumor 1.200 1.6e-02
psoriasis -1.100 3.0e-05

Gene RIF (18)

AA Sequence

MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGG      1 - 70
GGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQ     71 - 140
QQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGL    141 - 210
HHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQR    211 - 280
RIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAA    281 - 350
QGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP    351 - 420
GAEDVYGGSRDTPPHHGVQTPVQ                                                   421 - 443
//

Text Mined References (44)

PMID Year Title