Property Summary

NCBI Gene PubMed Count 13
PubMed Score 134.04
PubTator Score 82.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 3.9e-16
facioscapulohumeral dystrophy 2.800 1.1e-04
group 3 medulloblastoma -4.900 4.1e-09
medulloblastoma, large-cell -2.900 1.7e-02
psoriasis -1.200 1.3e-30

 GO Component (1)

Gene RIF (3)

AA Sequence

MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSV      1 - 70
KMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASSPWSGSAVGMAGSPQQPPQPP     71 - 140
PPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPHQGHPGGWGAAAAAAAAAAAAAAAAHLPSMA    141 - 210
GGQQPPPQSLLYSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHP    211 - 280
HPPHPHHAQGPPHHGGGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTL    281 - 350
YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA    351 - 420
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPP    421 - 490
PHHGLQTSVQ                                                                491 - 500
//

Text Mined References (14)

PMID Year Title