Property Summary

NCBI Gene PubMed Count 13
Grant Count 18
R01 Count 2
Funding $1,687,780.41
PubMed Score 129.34
PubTator Score 82.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -4.900 0.000
medulloblastoma, large-cell -2.900 0.017
Breast cancer -1.700 0.000
psoriasis -1.200 0.000
facioscapulohumeral dystrophy 2.800 0.000

 GO Component (1)

Gene RIF (3)

PMID Text
26510906 Data show that the long noncoding RNA encoded by a gene next to POU3F3 (linc-POU3F3) is a potential therapeutic target and novel molecular biomarker for colorectal cancer (CRC).
25445282 linc-POU3F3 might affect glioma development via altering expression level of POU3F3, and may also have a crucial regulatory role in glioma progression
24631494 Long intergenic non-protein coding RNA POU3F3 contributes to the development of ESCC by interacting with EZH2 to promote methylation of POU3F3, which encodes a transcription factor.

AA Sequence

MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSV      1 - 70
KMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASSPWSGSAVGMAGSPQQPPQPP     71 - 140
PPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPHQGHPGGWGAAAAAAAAAAAAAAAAHLPSMA    141 - 210
GGQQPPPQSLLYSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHP    211 - 280
HPPHPHHAQGPPHHGGGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTL    281 - 350
YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA    351 - 420
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPP    421 - 490
PHHGLQTSVQ                                                                491 - 500
//

Text Mined References (14)

PMID Year Title
26510906 2016 Knockdown of linc-POU3F3 suppresses the proliferation, apoptosis, and migration resistance of colorectal cancer.
25445282 2015 Functional linc-POU3F3 is overexpressed and contributes to tumorigenesis in glioma.
24631494 2014 Increased levels of the long intergenic non-protein coding RNA POU3F3 promote DNA methylation in esophageal squamous cell carcinoma cells.
24550763 2014 A de novo POU3F3 Deletion in a Boy with Intellectual Disability and Dysmorphic Features.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22892427 2013 POU-III transcription factors (Brn1, Brn2, and Oct6) influence neurogenesis, molecular identity, and migratory destination of upper-layer cells of the cerebral cortex.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15713637 2005 The class III POU domain protein Brn-1 can fully replace the related Oct-6 during schwann cell development and myelination.
9632656 1998 Cooperative function of POU proteins and SOX proteins in glial cells.
More...