Property Summary

NCBI Gene PubMed Count 184
Grant Count 64
R01 Count 54
Funding $6,948,322.04
PubMed Score 164.50
PubTator Score 957.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P20248 A8K7B6 Q2M3U6 Q4W5P4 Q6LER8 Cyclin-A
Symbols CCN1
CCNA

Gene

PDB

1H26   2CCH   2CCI   1H28   1E9H   1FIN   1FVV   1GY3   1H1P   1H1Q   1H1R   1H1S   1H24   1H25   1H27   1JST   1JSU   1OGU   1OI9   1OIU   1OIY   1OKV   1OKW   1OL1   1OL2   1P5E   1PKD   1QMZ   1URC   1VYW   2BKZ   2BPM   2C4G   2C5N   2C5O   2C5V   2C5X   2C6T   2CJM   2I40   2IW6   2IW8   2IW9   2UUE   2UZB   2UZD   2UZE   2UZL   2V22   2WEV   2WFY   2WHB   2WIH   2WIP   2WMA   2WMB   2WPA   2WXV   2X1N   3EID   3EJ1   3EOC   3F5X   4BCK   4BCM   4BCN   4BCP   4CFM   4CFN   4CFU   4CFV   4CFW   4CFX   4EOI   4EOJ   4EOK   4EOL   4EOM   4EON   4EOO   4EOP   4EOQ   4EOR   4EOS   4FX3   5CYI   5IF1  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
651681 confirmatory 0 / 0 / 45 MLPCN Dyrk1A - CDK2 selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-06_Inhibitor_Dose_DryPowder_Activity_Set3

Gene RIF (114)

PMID Text
26960431 Study describes a positive feedback loop centred on cyclin A2-Cdk2 inhibition of interphase APC/C-Cdc20 to allow further cyclin A2 accumulation and mitotic entry.
26706989 On analyzing cyclin A and B1 (CCNA and CCNB1) expression, positive staining in 90% cases of PTC were observed. The study revealed a significant difference in expression of cyclins A and B1 between classic and non-classic variants of PTC.
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
26373553 PIWIL2 has a role in promoting progression of non-small cell lung cancer by inducing CDK2 and Cyclin A expression
26240284 HDAC10 regulates cyclin A2 expression by deacetylating histones near the let-7 promoter.
25615569 CCN2 is a regulator of the transition through cytokinesis during terminal erythropoiesis.
25596928 our data showed that bile acid-activated FXR stimulates miR-22-silenced CCNA2, a novel pathway for FXR to exert its protective effect in the gastrointestinal tract.
25501285 Expression of cycle marker cyclin A1 differs between benign and malignant papillary breast lesions.
25393019 Cyclin A2-binding function of pUL21a contributes to the maintenance of a cell cycle state conducive for the completion of the human cytomegalovirus (HCMV) replication cycle.
25340978 for the first time, we demonstrated that CTD induced G2/M phase arrest via the inhibition of Cdc25c and cyclin A and induced apoptosis was through death receptor (extrinsic), intrinsic (mitochondria) and ER stress pathways in A375. S2 cells.
More...

AA Sequence

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR      1 - 70
RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP     71 - 140
LVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM    141 - 210
RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY    211 - 280
ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY    281 - 350
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG    351 - 420
VSLLNPPETLNL                                                              421 - 432
//

Text Mined References (190)

PMID Year Title
26960431 2016 Interphase APC/C-Cdc20 inhibition by cyclin A2-Cdk2 ensures efficient mitotic entry.
26706989 2015 Patterns of cyclin A and B1 immunostaining in papillary thyroid carcinoma.
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26373553 2015 PIWIL2 promotes progression of non-small cell lung cancer by inducing CDK2 and Cyclin A expression.
26240284 2015 Histone Deacetylase 10 Regulates the Cell Cycle G2/M Phase Transition via a Novel Let-7-HMGA2-Cyclin A2 Pathway.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25615569 2015 Genome-wide association study follow-up identifies cyclin A2 as a regulator of the transition through cytokinesis during terminal erythropoiesis.
25596928 2015 MiR-22-silenced cyclin A expression in colon and liver cancer cells is regulated by bile acid receptor.
25501285 2015 Cell cycle marker expression in benign and malignant intraductal papillary lesions of the breast.
More...