Property Summary

NCBI Gene PubMed Count 81
PubMed Score 108.03
PubTator Score 73.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Amebiasis 22 3.413 1.7

Expression

Gene RIF (54)

PMID Text
26089601 Elevated serum tryptase and ET-1 may be markers of increased coronary instability; some cytokines may be related to the extension of CAD.
26044856 We found the determination of serum tryptase levels over time to be a reassuring correlate of clinical improvement in pediatric mastocytosis
25797204 genetic polymorphism is associated with Dengue Hemorrhagic Fever and Dengue Shock Syndrome in Vietnam and Philippines
24915568 Results demonstrated serum tryptase levels in colo-rectal cancer (CRC) patients before radical surgical resection.
24830464 Circulating tryptase level is associated to obesity related parameters and has a close relation with various metabolic risk factors for subclinical atherosclerosis
24806698 these data suggest that the expression of tryptase is regulated by SCF/C-KIT signaling via the ERK1/2 and p38MAPK pathways.
24726923 Urine tryptase beta was increased in patients with chronic prostatitis/chronic pelvic pain syndrome compared to controls.
24565497 With elevated tryptase level, a history of hornet sting-triggered anaphylaxis, and venom-specific IgE, a patient is at increased risk of severe life-threatening anaphylactic response to a future sting, as well as for having underlying clonal mastocytosis.
24507159 The accumulated data in this review suggest that mast cells and their tryptases and chymases play important roles in tissue repair.
24372627 Alpha-tryptase gene variation is associated with levels of circulating IgE and lung function in asthma.
24237068 The best criterion for discriminating IgE- and non IgE-mediated hypersensitivity reactions in anaesthesia was a tryptase value exceeding twice the basal one.
24155887 Monitoring of serum baseline tryptase in indolent systemic mastocytosis patients is closely associated with poor prognosis disease features as well as with disease progression.
24054365 As much as 82% of the variation in serum tryptase is due to genetics factors, and genetic effects overlap serum tryptase and body mass index.
23991686 The high density of tryptase(+) Mmast cells at invasive margins of tumours was associated with advanced stages of colorectal cancer and was strongly correlated with PAR-2 expression.
23559352 The identification of an abundant population of tryptase(+)/Nanog(+) cells in infantile haemangioma is novel.
23330964 Our results indicate that sBT levels are associated with a higher risk of severe SR in children with insect venom hypersensitivity.
23018683 Tryptase is a biomarker related to the severity of anaphylaxis.
22613992 results suggest that tryptase can induce microglia activation and pro-inflammatory mediator release via PAR-2-MAPK-NF-kappa B signaling pathway, which will contribute to the development of microglia-mediated inflammation in brain
22363824 As mast cells are an important source of VEGF, tryptase, and chymase, these findings suggest that mast cell activation and mast cell-derived mediators participate in the development of Dengue hemorrhagic fever.
22194960 Both IgE and chymase associate with diabetes status.
22102069 Two different populations of mast cells were found in melanocytic skin; one expressing both chymase and tryptase and the other with tryptase only.
21791437 Mast cell tryptase stimulates production of decorin by human testicular peritubular cells
21707711 During breast cancer progression the mast cells may contribute to stromal remodelling and differentiation of myofibroblasts, through tryptase released in stromal microenvironment.
21493897 enhanced tryptase staining in media and adventitia of human and mouse abdominal aortic aneurysm lesions
20718781 these data show that patients suffering from active active chronic urticaria (CU) have significantly higher total tryptase levels than asymptomatic CU, atopics without CU and healthy subjects.
20540319 MCT gene may play a role in the pathogenesis of scar.
20087660 Tryptase seems to play an important role in the control of human colonic mucosal permeability, and enhanced tryptase activity was responsible for the increased permeability of rectal mucosa in irritable bowel patients
19748655 Strong linkage of TPSAB1 and TPSB2 and pairing of deficiency alleles with functional alleles in observed haplotypes protect human subjects from "knockout" genomes and indeed from inheritance of fewer than 2 active alleles.
19748655 Observational study of gene-disease association. (HuGE Navigator)
19697770 The levels of tryptase and chymase expression are greatly increased in human lung tissue of anaphylactic shock.
19625657 Proteolytic cleavage of cathelicidin LL-37 by mast cells (MC) is mediated by beta-tryptase, the the major LL-37 processing enzyme in MC.
19535787 SPAG11B/D is both a substrate and a potent inhibitor of TPSAB1 activity.
19250736 MC are immunoreactive to cathepsin-G in human cutaneous mastocytosis, as well as the co-localization of tryptase and cathepsin-G in MC secretory granules.
19100407 Positive correlation between serum tryptase concentration and hemoglobin, hematocrit, red blood cell count, and hepatic cell damage in kidney transplantation.
18854315 alternative mRNA splicing in multiple human tryptase genes has a role in regulating tetramer formation
18790994 Tryptase stimulation of human small airway epithelial cells increased membrane-associated, calcium-independent phospholipase A(2)gamma (iPLA(2)gamma) activity, resulting in increased arachidonic acid and PGE(2) release.
18359288 Tryptase activates TGFbeta via a PAR2-independent proteolytic mechanism in human ASM cells and may help understanding the role of tryptase in asthma.
18079491 Up-regulates interleukin-8 expression in airway smooth muscle cells through a protease-activated receptor(PAR)-2-independent proteolytic mechanism.
17655281 siHTbeta is for the most part an inactive species and any active monomer is a consequence of heparin binding to siHTbeta under dilute conditions where unfavorable thermodynamics and/or kinetics restrict formation of active tetramer.
17635650 These results suggest that the characteristic neovascularization observed in pterygium may be sustained, at least in part, by mast cells angiogenic mediators, in particular tryptase.
17449330 Observational study of gene-disease association. (HuGE Navigator)
17449330 The disease severity and plasma tryptase levels were not affected by the number of alpha or beta tryptase alleles in mastocytosis patients.
17205215 Mast cell tryptase secretion into rheumatoid arthritis synovial fluid is higher than Osteoarthritis synovial fluid and stimulates the proliferation of Synovial fibrobalst-like cells.
17146627 Bikunin was found to localize on the cell membrane, while tryptase was in the secretary granules of the mast cells from psoriatic lesions.
16517749 mast cell beta-tryptase selectively cleaves asthmatic airway smooth muscle (ASM)-derived eotaxin and RANTES and abrogates their chemotactic activities, thus providing an explanation for the eosinophil paucity in asthmatic ASM bundles
16414069 crystal structures of both the single and the double mutant forms of recombinant human alphaI-tryptase in complex with the peptide inhibitor leupeptin, as well as the structure of the non-inhibited single mutant
16027150 Mast cell tryptase cleaves protease-activated receptor 2 (PAR2) on colonocytes to increase paracellular permeability of the intestine during stress and inflammation.
15638376 Tryptase and chymase and protein levels were determined in mast cells in fibrosarcoma.
15567416 Results indicate a key role for heparin in the activation of human betaI- and beta2-tryptase.
12742661 Beta-tryptase activates peripheral blood mononuclear cells isolated from healthy donors as well as multiple sclerosis (MS) patients, inducing release of TNF-alpha, IL-6, and IL-1 beta, and is most probably an important mediator of inflammation in MS.
12397176 Proliferative action is mediated by PAR2, COX2, prostaglandins, and PPARgamma : possible relevance to human fibrotic disorders.
11906611 structure of Bowman-Birk inhibitor derived peptides
11876641 stability and catalytic properties mediated by residues at the S1 pocket
11792624 mitogenic effects in human airway smooth muscle cells

AA Sequence

MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVL      1 - 70
TAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTV     71 - 140
TLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML    141 - 210
CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP         211 - 275
//

Text Mined References (86)

PMID Year Title
26089601 2015 Elevated Serum Tryptase and Endothelin in Patients with ST Segment Elevation Myocardial Infarction: Preliminary Report.
26044856 2015 Assessment of clinical findings, tryptase levels, and bone marrow histopathology in the management of pediatric mastocytosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25797204 2015 Alpha tryptase allele of Tryptase 1 (TPSAB1) gene associated with Dengue Hemorrhagic Fever (DHF) and Dengue Shock Syndrome (DSS) in Vietnam and Philippines.
24915568 2014 Correlation between serum tryptase, mast cells positive to tryptase and microvascular density in colo-rectal cancer patients: possible biological-clinical significance.
24830464 2014 Circulating tryptase as a marker for subclinical atherosclerosis in obese subjects.
24806698 2014 SCF/C-KIT signaling modulates tryptase expression in acute myeloid leukemia cells.
24726923 2014 Tryptase-PAR2 axis in experimental autoimmune prostatitis, a model for chronic pelvic pain syndrome.
24565497 Anaphylactic reaction to white-faced hornet sting and elevated baseline (asymptomatic) serum tryptase.
24507159 2014 Development of mast cells and importance of their tryptase and chymase serine proteases in inflammation and wound healing.
24372627 2014 Alpha-tryptase gene variation is associated with levels of circulating IgE and lung function in asthma.
24237068 2014 The usefulness of plasma histamine and different tryptase cut-off points in the diagnosis of peranaesthetic hypersensitivity reactions.
24155887 2013 Serum tryptase monitoring in indolent systemic mastocytosis: association with disease features and patient outcome.
24054365 2013 Genetic factors account for most of the variation in serum tryptase--a twin study.
23991686 2013 High density of tryptase-positive mast cells in human colorectal cancer: a poor prognostic factor related to protease-activated receptor 2 expression.
23559352 2013 Mast cells in infantile haemangioma possess a primitive myeloid phenotype.
23330964 2013 Importance of serum basal tryptase levels in children with insect venom allergy.
23018683 2013 Usefulness and limitations of sequential serum tryptase for the diagnosis of anaphylaxis in 102 patients.
22613992 2012 Mast cell tryptase induces microglia activation via protease-activated receptor 2 signaling.
22363824 2012 Association of mast cell-derived VEGF and proteases in Dengue shock syndrome.
22194960 2011 Immunoglobulin E and mast cell proteases are potential risk factors of human pre-diabetes and diabetes mellitus.
22102069 2011 Mast cells in melanocytic skin lesions. An immunohistochemical and quantitative study.
21791437 2011 Mast cell tryptase stimulates production of decorin by human testicular peritubular cells: possible role of decorin in male infertility by interfering with growth factor signaling.
21707711 2011 Tissue remodelling in breast cancer: human mast cell tryptase as an initiator of myofibroblast differentiation.
21493897 2011 Mast cell tryptase deficiency attenuates mouse abdominal aortic aneurysm formation.
20718781 2010 Serum total tryptase levels are increased in patients with active chronic urticaria.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20540319 2010 [Expression of mast cell tryptase in scar].
20087660 2010 Subjects with diarrhea-predominant IBS have increased rectal permeability responsive to tryptase.
19748655 2009 Human subjects are protected from mast cell tryptase deficiency despite frequent inheritance of loss-of-function mutations.
19697770 2009 [Expression of tryptase and chymase in human lung tissue of anaphylactic shock].
19625657 2009 The cathelicidin LL-37 activates human mast cells and is degraded by mast cell tryptase: counter-regulation by CXCL4.
19535787 2009 Novel partners of SPAG11B isoform D in the human male reproductive tract.
19250736 2009 Co-localization of tryptase and cathepsin-G in mast cells in cutaneous mastocytosis.
19100407 2008 Mast cells tryptase in patients after renal transplantation.
18854315 2008 Alternate mRNA splicing in multiple human tryptase genes is predicted to regulate tetramer formation.
18790994 2008 Tryptase activates calcium-independent phospholipase A2 and releases PGE2 in airway epithelial cells.
18359288 2008 Tryptase activates TGFbeta in human airway smooth muscle cells via direct proteolysis.
18079491 2008 Beta-tryptase regulates IL-8 expression in airway smooth muscle cells by a PAR-2-independent mechanism.
18039527 2007 Active monomers of human beta-tryptase have expanded substrate specificities.
17655281 2007 Characterization of three distinct catalytic forms of human tryptase-beta: their interrelationships and relevance.
17635650 Neovascularization and mast cells with tryptase activity increase simultaneously in human pterygium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17449330 2007 Tryptase haplotype in mastocytosis: relationship to disease variant and diagnostic utility of total tryptase levels.
17205215 2007 Distinct expression of mast cell tryptase and protease activated receptor-2 in synovia of rheumatoid arthritis and osteoarthritis.
17146627 2007 The presence of tryptase-positive and bikunin-negative mast cells in psoriatic skin lesions.
16517749 2006 Mast cell beta-tryptase selectively cleaves eotaxin and RANTES and abrogates their eosinophil chemotactic activities.
16414069 2006 X-ray structures of free and leupeptin-complexed human alphaI-tryptase mutants: indication for an alpha-->beta-tryptase transition.
16027150 2005 Mast cell tryptase controls paracellular permeability of the intestine. Role of protease-activated receptor 2 and beta-arrestins.
15638376 2004 Immunohistochemical evaluation of mast cells and mark activity tryptase and chymase in experimental fibrosarcoma.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15567416 2005 Structural requirements and mechanism for heparin-dependent activation and tetramerization of human betaI- and betaII-tryptase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14670919 2004 Intracellular serpin SERPINB6 (PI6) is abundantly expressed by human mast cells and forms complexes with beta-tryptase monomers.
12874242 2003 Human mast cell beta-tryptase is a gelatinase.
12742661 2003 Tryptase activates peripheral blood mononuclear cells causing the synthesis and release of TNF-alpha, IL-6 and IL-1 beta: possible relevance to multiple sclerosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397176 2002 Proliferative action of mast-cell tryptase is mediated by PAR2, COX2, prostaglandins, and PPARgamma : Possible relevance to human fibrotic disorders.
12391231 2002 Delta tryptase is expressed in multiple human tissues, and a recombinant form has proteolytic activity.
12217407 2002 New developments in the genetics and activation of mast cell proteases.
12100045 2002 Genetic deficiency of human mast cell alpha-tryptase.
11568008 2001 Expression of mast cell tryptase by myeloblasts in a group of patients with acute myeloid leukemia.
11533057 2001 Structural requirements and mechanism for heparin-induced activation of a recombinant mouse mast cell tryptase, mouse mast cell protease-6: formation of active tryptase monomers in the presence of low molecular weight heparin.
11325588 2001 Bivalent inhibition of human beta-tryptase.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10898108 2000 Characterization of two highly polymorphic human tryptase loci and comparison with a newly discovered monkey tryptase ortholog.
10843716 2000 Characterization of human gamma-tryptases, novel members of the chromosome 16p mast cell tryptase and prostasin gene families.
10708866 2000 Granzymes (lymphocyte serine proteases): characterization with natural and synthetic substrates and inhibitors.
10708850 2000 The human mast cell tryptase tetramer: a fascinating riddle solved by structure.
10514402 1999 Tryptase-chymase double-positive human mast cells express the eotaxin receptor CCR3 and are attracted by CCR3-binding chemokines.
10500112 1999 The structure of the human betaII-tryptase tetramer: fo(u)r better or worse.
10391906 1999 Human tryptases alpha and beta/II are functionally distinct due, in part, to a single amino acid difference in one of the surface loops that forms the substrate-binding cleft.
9920877 1999 Characterization of genes encoding known and novel human mast cell tryptases on chromosome 16p13.3.
9521329 1998 Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
9485375 1998 Human mast cell tryptase fibrinogenolysis: kinetics, anticoagulation mechanism, and cell adhesion disruption.
9300715 1997 Effect of recombinant human IL-4 on tryptase, chymase, and Fc epsilon receptor type I expression in recombinant human stem cell factor-dependent fetal liver-derived human mast cells.
9077541 1997 Mast cell tryptase stimulates the synthesis of type I collagen in human lung fibroblasts.
8675637 1995 The alpha form of human tryptase is the predominant type present in blood at baseline in normal subjects and is elevated in those with systemic mastocytosis.
8598474 1996 Mast cell tryptase is a mitogen for epithelial cells. Stimulation of IL-8 production and intercellular adhesion molecule-1 expression.
8434231 1993 Characterization of a tryptase mRNA expressed in the human basophil cell line KU812.
7730649 1995 Quantitation of tryptase, chymase, Fc epsilon RI alpha, and Fc epsilon RI gamma mRNAs in human mast cells and basophils by competitive reverse transcription-polymerase chain reaction.
7009736 1981 Acid hydrolases and tryptase from secretory granules of dispersed human lung mast cells.
3161948 1985 The fibrinogenolytic activity of purified tryptase from human lung mast cells.
2677049 1989 Cloning and characterization of complementary DNA for human tryptase.
2203827 1990 Cloning and characterization of a second complementary DNA for human tryptase.
2187193 1990 Human mast cell tryptase: multiple cDNAs and genes reveal a multigene serine protease family.