Property Summary

NCBI Gene PubMed Count 87
PubMed Score 113.00
PubTator Score 73.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Amebiasis 21 3.333 1.7
Meningococcal meningitis 8 3.106 1.6

Expression

Gene RIF (59)

AA Sequence

MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVL      1 - 70
TAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTV     71 - 140
TLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML    141 - 210
CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP         211 - 275
//

Text Mined References (92)

PMID Year Title