Property Summary

NCBI Gene PubMed Count 249
Grant Count 621
R01 Count 466
Funding $68,489,635.43
PubMed Score 1750.59
PubTator Score 1112.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis -1.100 0.002
osteosarcoma -1.421 0.000
group 3 medulloblastoma 1.400 0.001
acute myeloid leukemia -1.600 0.035
ovarian cancer -1.500 0.000

Synonym

Accession P20226 B4E3B3 F5H869 Q16845 Q6IBM6 Q9UC02
Symbols HDL4
GTF2D
SCA17
TFIID
GTF2D1

Gene

TBP

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1C9B   1JFI   1NVP   5FUR   1CDW   1TGH   4ROC   4ROD   4ROE  

Gene RIF (131)

PMID Text
26505791 TBP attenuates Msx1-mediated glycoprotein hormone alpha transcriptional repression.
26339052 this analysis of the 2.2-kb doubly spliced RNA (2.2DS-RNA) -mediated suppression of viral RNA expression showed that 2.2DS-RNA inhibited transcription via binding to the TATA-binding protein and stress granule proteins.
26267067 Study could not determine a definitive cutoff value for the pathologic CAG repeat number of SCA17.
25996597 Our results provide first evidence that Taspase1 processing affects TFIIA regulation of TFIID and suggest that Taspase1 processing of TFIIA is required to establish INR-selective core promoter activity in the presence of NC2.
25810277 TBP (and GATA2 and Sp1) have key roles in inflammation and ischemia-like conditions through MAOA regulation.
25104854 Deactivation of TBP contributes to SCA17 pathogenesis.
24886930 HIV-1 Vpr (amino acids 1-35) binds to TFIID, an interaction that is associated with the ability of Vpr to stimulate transcription through the glucocorticoid receptor pathway
24418534 The UL4 protein directly interacted with the host TBP and the carboxy-terminal domain of RNA polymerase II in infected cells.
24243817 HOXA2 acts as a suppressor or TBP-antagonist to inhibit MMP-9 expression; while methylation-mediated inactivation of HOXA2 in NPC derepresses MMP-9 production and increases invasion of NPC cells.
24039962 The data reveal synergistic effects of H3K4me3, H3K14ac and a TATA box sequence on TFIID binding in vitro. Stoichiometry analyses of affinity purified human TFIID identified the presence of a stable dimeric core.
More...

AA Sequence

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQ      1 - 70
QQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYP     71 - 140
SPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTT    141 - 210
ALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQF    211 - 280
SSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT               281 - 339
//

Text Mined References (256)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
26638071 2015 Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
26505791 2015 Msx1 homeodomain transcription factor and TATA-binding protein interact to repress the expression of the glycoprotein hormone ? subunit gene.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26339052 2015 Doubly Spliced RNA of Hepatitis B Virus Suppresses Viral Transcription via TATA-Binding Protein and Induces Stress Granule Assembly.
26267067 2015 The Pathogenic Role of Low Range Repeats in SCA17.
26002199 2015 The Repeat Expansion Diseases: The dark side of DNA repair.
25996597 2015 Taspase1 processing alters TFIIA cofactor properties in the regulation of TFIID.
25810277 2015 Molecular mechanism of monoamine oxidase A gene regulation under inflammation and ischemia-like conditions: key roles of the transcription factors GATA2, Sp1 and TBP.
More...