Property Summary

NCBI Gene PubMed Count 253
PubMed Score 1844.44
PubTator Score 1112.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
PARKINSON DISEASE, LATE-ONSET 20 0.0 0.0
SPINOCEREBELLAR ATAXIA 17 9 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 1.4e-07
ovarian cancer 8520 3.3e-07
osteosarcoma 7950 1.1e-05
group 3 medulloblastoma 4104 8.1e-04
psoriasis 6694 1.6e-03
acute myeloid leukemia 783 3.5e-02
Disease Target Count
Spinocerebellar ataxia type 17 7

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.600 3.5e-02
group 3 medulloblastoma 1.400 8.1e-04
malignant mesothelioma 1.800 1.4e-07
osteosarcoma -1.421 1.1e-05
ovarian cancer -1.500 3.3e-07
psoriasis -1.100 1.6e-03

PDB (18)

Gene RIF (119)

AA Sequence

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQ      1 - 70
QQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYP     71 - 140
SPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTT    141 - 210
ALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQF    211 - 280
SSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT               281 - 339
//

Text Mined References (260)

PMID Year Title