Property Summary

NCBI Gene PubMed Count 59
PubMed Score 282.23
PubTator Score 161.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.2e-12
Waldenstrons macroglobulinemia 765 2.6e-02
Rheumatoid arthritis 1191 3.1e-02
Disease Target Count Z-score Confidence
Vasculitis 80 3.324 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -7.423 6.2e-12
Rheumatoid arthritis -1.400 3.1e-02
Waldenstrons macroglobulinemia 2.993 2.6e-02

Gene RIF (24)

AA Sequence

MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQ      1 - 70
SQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQN     71 - 140
ATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGL    141 - 210
AHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA                                 211 - 251
//

Text Mined References (64)

PMID Year Title