Property Summary

NCBI Gene PubMed Count 59
Grant Count 37
R01 Count 23
Funding $4,974,476.01
PubMed Score 245.35
PubTator Score 161.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.031
Waldenstrons macroglobulinemia 2.993 0.026
osteosarcoma -7.423 0.000

Gene RIF (24)

PMID Text
26170148 Neuronal CAP37 may modulate the neuroinflammatory response in Alzheimer disease.
25412625 identified a multifunctional bioactive peptide, based on CAP37, that induces cell migration, possesses antibacterial and LPS-binding activity, and is effective at healing infected and noninfected corneal wounds in vivo.
23883488 Plasma levels of heparin-binding protein were significantly higher in patients with acute respiratory distress syndrome.
23808364 Low levels of azurocidin in maternal serum in the first trimester were associated with subsequent preterm prelabor rupture of membranes.
22278372 AZU1 exhibited high affinity binding to PTX3 in a calcium ion-dependent manner
22207392 Heparin-binding protein is elevated in patients with shock from septic and non-septic etiologies.
20399025 Proliferating bile ductules may play a role in the inflammatory response in biliary atresia through expression of CAP37.
20107486 group A streptococci induce contact activation and HBP release during skin infection, which likely contribute to the symptoms seen in erysipelas: fever, pain, erythema, and edema
20083497 The TAASC motif in a cyclizised 20-44 amino acid peptide is part of the ligand in HBP responsible for activation of the HBP receptor on monocytes. Monocytes release HBP constitutively in small amounts and more so in the presence of lipopolysaccharide.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQ      1 - 70
SQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQN     71 - 140
ATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGL    141 - 210
AHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA                                 211 - 251
//

Text Mined References (64)

PMID Year Title
26170148 2015 The antimicrobial protein, CAP37, is upregulated in pyramidal neurons during Alzheimer's disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25412625 2015 A multifunctional peptide based on the neutrophil immune defense molecule, CAP37, has antibacterial and wound-healing properties.
24008408 2013 CAP37 activation of PKC promotes human corneal epithelial cell chemotaxis.
23883488 2013 Increased plasma levels of heparin-binding protein in patients with acute respiratory distress syndrome.
23808364 2014 Azurocidin levels in maternal serum in the first trimester can predict preterm prelabor rupture of membranes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22278372 2012 The proteomic profile of circulating pentraxin 3 (PTX3) complex in sepsis demonstrates the interaction with azurocidin 1 and other components of neutrophil extracellular traps.
22207392 2012 Increased plasma levels of heparin-binding protein in patients with shock: a prospective, cohort study.
More...