Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.25
PubTator Score 11.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 480 0.0182456319733127
osteosarcoma 7933 0.0182974515309797

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.674 0.018
mucosa-associated lymphoid tissue lympho... -1.711 0.018

Synonym

Accession P20155 Q6FGH2
Symbols HUSI-II

Gene

PDB

2JXD  

Gene RIF (2)

PMID Text
19422058 Data showed that the expression level of SPINK2 is significantly elevated in most leukemia cell lines except B-lymphoblast TK-6 cells. Data demonstrated that Arg(24) at the P1 site is crucial for the specificity of SPINK2 on target enzyme.
17333166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIR      1 - 70
EGGHNIKIIRNGPC                                                             71 - 84
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19422058 2009 Identification of trypsin-inhibitory site and structure determination of human SPINK2 serine proteinase inhibitor.
17333166 2007 The SPINK gene family and celiac disease susceptibility.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15120973 2004 Gene expression patterns associated with infertility in humans and rodent models.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8428671 1993 Organization and sequence of the gene encoding the human acrosin-trypsin inhibitor (HUSI-II).
More...