Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.25
PubTator Score 11.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.674 0.018
mucosa-associated lymphoid tissue lympho... -1.711 0.018

Synonym

Accession P20155 Q6FGH2
Symbols HUSI-II

Gene

PDB

2JXD  

Gene RIF (2)

PMID Text
19422058 Data showed that the expression level of SPINK2 is significantly elevated in most leukemia cell lines except B-lymphoblast TK-6 cells. Data demonstrated that Arg(24) at the P1 site is crucial for the specificity of SPINK2 on target enzyme.
17333166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIR      1 - 70
EGGHNIKIIRNGPC                                                             71 - 84
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19422058 2009 Identification of trypsin-inhibitory site and structure determination of human SPINK2 serine proteinase inhibitor.
17333166 2007 The SPINK gene family and celiac disease susceptibility.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15120973 2004 Gene expression patterns associated with infertility in humans and rodent models.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8428671 1993 Organization and sequence of the gene encoding the human acrosin-trypsin inhibitor (HUSI-II).
More...