Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.16
PubTator Score 11.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.711 1.8e-02
osteosarcoma -1.674 1.8e-02

Gene RIF (2)

AA Sequence

MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIR      1 - 70
EGGHNIKIIRNGPC                                                             71 - 84
//

Text Mined References (14)

PMID Year Title