Property Summary

Ligand Count 3
NCBI Gene PubMed Count 76
PubMed Score 149.90
PubTator Score 151.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
diabetes mellitus 1728 2.2e-03
Disease Target Count Z-score Confidence
Prostate cancer 175 6.02 3.0
Prostate disease 2 3.489 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 2.2e-03

Protein-protein Interaction (3)

Gene RIF (48)

AA Sequence

MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKN      1 - 70
SQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLG     71 - 140
LPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCG    141 - 210
GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP                       211 - 261
//

Text Mined References (77)

PMID Year Title