Property Summary

NCBI Gene PubMed Count 76
Grant Count 40
R01 Count 15
Funding $6,592,733.16
PubMed Score 146.88
PubTator Score 151.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 0.002

 GWAS Trait (2)

Gene RIF (48)

PMID Text
26582203 glycosylation changes the enzymatic activity of KLK2 in a drastically substrate-dependent manner.
25847286 The results indicated that W-hK2 had a defect in cellular trafficking due to its misfolding and that it activated the unfolded protein response, suggesting a mechanism to explain the association of the T allele with higher prostate cancer risk.
25326387 Structure-function analyses of KLK2 establish the 99-loop as master regulator of its activity.
25153393 The differential regulation of alternative transcripts (using KLK2, KLK3 and KLK4 as models) by androgens and anti-androgens as an indicator of prostate cancers, was investigated.
25153390 miR-378 was predicted to target both KLK2 and KLK4 and downregulated levels detected in prostate cancer patients.
24711254 Alteration of cellular junctions in benign prostatic hyperplasia could contribute to the presence of luminal epithelial secreted proteins prostate specific antigen (PSA)2 and and KLK2 in the stromal compartment.
24270797 Associations observed in young, healthy men between the seminal plasma and serum concentrations of hK2 and PSA and several genetic variants in KLK2 and KLK3 could be useful to refine models of PSA cutoff values in prostate cancer testing.
24122203 we present the first evidence that KLK2 can also function as an androgen receptor modulator that may modulate cell growth after the development of castration-resistant prostate cancer
23683475 Predictions based on levels of four kallikrein markers, including KLK2, in blood distinguish between pathologically insignificant and aggressive disease after radical prostatectomy with good accuracy.
23555189 Two SNPs, in beta-microseminoprotein at and in kallikrein-related peptidase 2 at, are associated with PCA3 score at genome-wide significance level
More...

AA Sequence

MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKN      1 - 70
SQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLG     71 - 140
LPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCG    141 - 210
GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP                       211 - 261
//

Text Mined References (77)

PMID Year Title
26582203 2016 A Single Glycan at the 99-Loop of Human Kallikrein-related Peptidase 2 Regulates Activation and Enzymatic Activity.
25847286 2015 Trp(250) -hK2 is defective in intracellular trafficking and activates the unfolded protein response.
25326387 2014 Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity.
25153393 2014 Analysis of androgen and anti-androgen regulation of KLK-related peptidase 2, 3, and 4 alternative transcripts in prostate cancer.
25153390 2014 Loss of miR-378 in prostate cancer, a common regulator of KLK2 and KLK4, correlates with aggressive disease phenotype and predicts the short-term relapse of the patients.
24711254 2014 Proteomic analysis of patient tissue reveals PSA protein in the stroma of benign prostatic hyperplasia.
24270797 2014 Genetic variation in KLK2 and KLK3 is associated with concentrations of hK2 and PSA in serum and seminal plasma in young men.
24122203 2014 Human kallikrein 2 (KLK2) promotes prostate cancer cell growth via function as a modulator to promote the ARA70-enhanced androgen receptor transactivation.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23683475 2013 Predictive value of four kallikrein markers for pathologically insignificant compared with aggressive prostate cancer in radical prostatectomy specimens: results from the European Randomized Study of Screening for Prostate Cancer section Rotterdam.
More...