Property Summary

NCBI Gene PubMed Count 65
Grant Count 55
R01 Count 26
Funding $4,615,319.34
PubMed Score 492.09
PubTator Score 320.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
non-small cell lung cancer -3.923 0.000
intraductal papillary-mucinous adenoma (... 5.200 0.001
lung cancer -3.700 0.000
sarcoidosis -3.100 0.010
diabetes mellitus 1.100 0.001
lung adenocarcinoma -4.900 0.000
lung carcinoma -4.500 0.000
psoriasis -1.300 0.000

Gene RIF (41)

PMID Text
26158864 Data show that SNP interactions among H. pylori-related genes PGC, PTPN11, and IL1B, are associated with susceptibility to gastric carcinogenesis.
25857852 Results suggest that rs9471643 CG and rs6458238 AG/AA genotypes have important roles in up-regulating PGC expression, which may partially explain why individuals with these favorable genotypes have decreased risks of getting gastric cancer.
25551587 The results highlight an important role of PGC rs3789210 and rs6939861 in altering susceptibility to atrophic gastritis and/or gastric cancer.
25028655 Pepsinogen II is a good marker of corpus morphological changes before and after H. pylori eradication.
24895149 High serum Pepsinogen II level is associ9ated with the progression of gastric precancerous lesions.
24586594 An interaction effect of pri-let-7a-1 rs10739971 polymorphism with ERCC6 rs1917799 polymorphism was observed for the risk of gastric cancer.
24284944 Pepsin and pepsinogen in middle ear effusion are probably caused by LPR and may be involved in the pathogenesis of OME.
24009139 High serum pepsinogen II is associated with gastric cancer development and activity of Helicobacter pylori-associated chronic gastritis.
23455381 PGC rs6458238, PGC rs4711690 and PTPN11 rs12229892 were associated with susceptibilities to atrophic gastritis and/or gastric cancer.
23326145 plasma PG II level significantly correlated with H. pylori-infected gastric cancer
More...

AA Sequence

MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMD      1 - 70
AAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLT     71 - 140
GFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVF    141 - 210
SVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTS    211 - 280
LLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPT    281 - 350
YLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA                                    351 - 388
//

Text Mined References (66)

PMID Year Title
26158864 2015 SNP interactions of Helicobacter pylori-related host genes PGC, PTPN11, IL1B, and TLR4 in susceptibility to gastric carcinogenesis.
25857852 2016 Polymorphic rs9471643 and rs6458238 upregulate PGC transcription and protein expression in overdominant or dominant models.
25551587 2014 PGC TagSNP and its interaction with H. pylori and relation with gene expression in susceptibility to gastric carcinogenesis.
25028655 2014 Pepsinogen II can be a potential surrogate marker of morphological changes in corpus before and after H. pylori eradication.
24895149 2015 Temporal changes in serum biomarkers and risk for progression of gastric precancerous lesions: a longitudinal study.
24586594 2014 The interaction effects of pri-let-7a-1 rs10739971 with PGC and ERCC6 gene polymorphisms in gastric cancer and atrophic gastritis.
24284944 2014 Role of pepsin and pepsinogen: linking laryngopharyngeal reflux with otitis media with effusion in children.
24009139 2014 Cancer development based on chronic active gastritis and resulting gastric atrophy as assessed by serum levels of pepsinogen and Helicobacter pylori antibody titer.
23455381 2013 Helicobacter pylori-related host gene polymorphisms associated with susceptibility of gastric carcinogenesis: a two-stage case-control study in Chinese.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...