Property Summary

Ligand Count 13
NCBI Gene PubMed Count 67
PubMed Score 526.55
PubTator Score 320.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 5.200 8.8e-04
lung adenocarcinoma -2.100 9.4e-06
lung cancer -3.700 2.6e-06
lung carcinoma -4.500 4.8e-24
non-small cell lung cancer -2.954 1.8e-11
psoriasis -1.300 4.9e-04
sarcoidosis -2.900 1.1e-02

Gene RIF (43)

AA Sequence

MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMD      1 - 70
AAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLT     71 - 140
GFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVF    141 - 210
SVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTS    211 - 280
LLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPT    281 - 350
YLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA                                    351 - 388
//

Text Mined References (68)

PMID Year Title