Property Summary

NCBI Gene PubMed Count 75
Grant Count 247
R01 Count 141
Funding $51,643,007.97
PubMed Score 752.94
PubTator Score 888.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.429 0.000
glioblastoma 1.100 0.002
tuberculosis 2.500 0.000
non-small cell lung cancer -1.564 0.000
lung carcinoma -1.600 0.000

Synonym

Accession P20138 B4E3P8 C9JEN7 F8WAL2 Q8TD24
Symbols p67
SIGLEC3
SIGLEC-3

Gene

Gene RIF (55)

PMID Text
26621708 this study investigated the contribution of the immunoregulatory receptor CD33 to a uniquely human postreproductive disease, Alzheimer's dementia.
26455864 CD33 and MS4A cluster variants are associated with LOAD susceptibility in East Asian populations.
26449541 There is substantial evidence that rs3865444 (CD33) function is related to AD pathways and pathology, but our data does not support an interaction with rs670139 (MS4A4E) that impacts AD risk.
26414614 decreased TREM2 expression with CD33 suppression and elevated cortical TREM2 mRNA expression with amyloid pathology
26102276 Among those with one or more APOE epsilon4 alleles, having one or more copies of the CD33 C (risk) allele may further increase the risk of cognitive decline
25883042 Studies indicate that anti-CD19 and anti-CD33 bispecific antibodies showed anticancer activity.
25762156 we propose a model wherein a modest effect on RNA splicing is sufficient to mediate the CD33 association with AD risk and suggest the potential for an anti-CD33 antibody as an AD-relevant pharmacologic agent.
25448602 Its single-nucleotide polymorphism rs3865444 in the CD33 gene as being associated with the reduced risk of developing Alzheimer's disease.
25320078 Lectin galactoside-binding soluble 3 binding protein (LGALS3BP) is a tumor-associated immunomodulatory ligand for CD33-related Siglecs.
25186233 the CD33 rs3865444 polymorphism is associated with Alzheimer's disease susceptibility in Chinese, European, and North American populations.
More...

AA Sequence

MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRD      1 - 70
SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD     71 - 140
LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL    141 - 210
TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF    211 - 280
IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP    281 - 350
SKDTSTEYSEVRTQ                                                            351 - 364
//

Text Mined References (77)

PMID Year Title
26621708 2016 Human-specific derived alleles of CD33 and other genes protect against postreproductive cognitive decline.
26455864 2015 Association of CD33 and MS4A cluster variants with Alzheimer's disease in East Asian populations.
26449541 2016 Interaction between variants in CLU and MS4A4E modulates Alzheimer's disease risk.
26414614 2015 CD33 modulates TREM2: convergence of Alzheimer loci.
26102276 2015 Effect of APOE and CD33 on Cognitive Decline.
25883042 2015 Clinical overview of anti-CD19 BiTE(®) and ex vivo data from anti-CD33 BiTE(®) as examples for retargeting T cells in hematologic malignancies.
25762156 2015 Genetics of CD33 in Alzheimer's disease and acute myeloid leukemia.
25448602 2015 Association of CD33 polymorphism rs3865444 with Alzheimer's disease pathology and CD33 expression in human cerebral cortex.
25416956 2014 A proteome-scale map of the human interactome network.
25320078 2014 Lectin galactoside-binding soluble 3 binding protein (LGALS3BP) is a tumor-associated immunomodulatory ligand for CD33-related Siglecs.
More...