Property Summary

Ligand Count 1
NCBI Gene PubMed Count 83
PubMed Score 774.44
PubTator Score 888.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 2.4e-03
lung carcinoma -1.600 2.6e-19
non-small cell lung cancer -1.564 2.8e-20
osteosarcoma -2.429 7.9e-05
tuberculosis 2.500 3.3e-08

Protein-protein Interaction (4)

Gene RIF (62)

AA Sequence

MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRD      1 - 70
SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD     71 - 140
LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL    141 - 210
TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF    211 - 280
IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP    281 - 350
SKDTSTEYSEVRTQ                                                            351 - 364
//

Text Mined References (85)

PMID Year Title