Property Summary

NCBI Gene PubMed Count 50
Grant Count 48
R01 Count 28
Funding $5,471,858.85
PubMed Score 437.27
PubTator Score 113.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.438 0.003
Multiple myeloma 1.978 0.000
psoriasis 1.300 0.000
osteosarcoma 1.268 0.005
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.900 0.000
adult high grade glioma -1.100 0.003
lung carcinoma 1.300 0.000
ovarian cancer 1.600 0.007

Gene RIF (25)

PMID Text
26067607 data reveal that high UBE3C expression contributes to glioma progression by ubiquitination and degradation of ANXA7, and thus presents a novel and promising target for glioma therapy.
25400735 High annexin A7 expression is associated with poor differentiation in gastric cancer patients, and it may be a predictor for lymphatic metastasis.
25339368 miRNA-155 promoted the proliferation of prostate cancer cells by regulating ANX7 expression levels.
24865424 Alternative ANXA7 splicing was present in precursor cells, suggesting that glioblastoma cells inherit the trait from a potential tumor-initiating ancestor and that these cells exploit this the through accumulation of mutations that enhance EGFR signaling.
24864229 The role of distinct SGK1/FOXO3A-associated regulation in p53 versus ANXA7 responses were elucidated and proposed that aberrant SGK1 could affect reciprocal SGK1-FOXO3A-Akt regulation.
24188284 Annexin A7 expression was able to inhibit HCC lymph node metastasis, whereas knockdown of Annexin A7 expression significantly induced HCC metastasis to local lymph nodes.
24007983 Both annexin A7 and integrin beta4 were essential for small molecule, 6-amino-2, 3-dihydro-3-hydroxymethyl-1, 4-benzoxazine-induced autophagy.
23651924 by identifying ABO as an unprecedented modulator of ANXA7 as well as GCA and LC3 as interacting proteins of ANXA7, we demonstrated the possible mechanisms how ANXA7 regulates autophagy for the first time.
23582794 We have found ANXA7 to be functioning like a tumour promoter in HepG2 human hepatocellular carcinoma cells
23437197 The present observations demonstrate that enhanced eryptosis of annexin7 deficient cells is paralleled by increased adhesion of erythrocytes to the vascular wall, an effect, which may impact on microcirculation during ischemia.
More...

AA Sequence

MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPG      1 - 70
GYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQP     71 - 140
TYPSQINTDSFSSYPVFSPVSLDYSSEPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVD    141 - 210
VVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVL    211 - 280
IEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLY    281 - 350
QAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAF    351 - 420
FAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ      421 - 488
//

Text Mined References (54)

PMID Year Title
26067607 2015 Ubiquitin-protein ligase E3C promotes glioma progression by mediating the ubiquitination and degrading of Annexin A7.
25400735 2014 Expression of annexin A7 and its clinical significance in differentiation and metastasis of gastric carcinoma.
25339368 2015 microRNA-155 promotes the proliferation of prostate cancer cells by targeting annexin 7.
24865424 2014 Lineage-specific splicing of a brain-enriched alternative exon promotes glioblastoma progression.
24864229 2014 Diverse effects of ANXA7 and p53 on LNCaP prostate cancer cells are associated with regulation of SGK1 transcription and phosphorylation of the SGK1 target FOXO3A.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24188284 2013 Annexin A7 suppresses lymph node metastasis of hepatocarcinoma cells in a mouse model.
24007983 2013 Relationship between annexin A7 and integrin ?4 in autophagy.
23651924 2013 Identification of a small molecule targeting annexin A7.
23582794 2013 Down-regulation of ANXA7 decreases metastatic potential of human hepatocellular carcinoma cells in vitro.
More...