Property Summary

NCBI Gene PubMed Count 52
PubMed Score 453.41
PubTator Score 113.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 3.2e-03
atypical teratoid / rhabdoid tumor -1.100 4.9e-04
group 3 medulloblastoma -1.400 7.4e-03
lung carcinoma 1.300 1.6e-24
medulloblastoma, large-cell -1.900 1.6e-05
Multiple myeloma 1.978 3.0e-04
osteosarcoma 1.268 4.7e-03
ovarian cancer -1.100 5.1e-03
psoriasis 1.300 1.6e-04
Waldenstrons macroglobulinemia 1.438 3.0e-03

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPG      1 - 70
GYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQP     71 - 140
TYPSQINTDSFSSYPVFSPVSLDYSSEPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVD    141 - 210
VVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVL    211 - 280
IEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLY    281 - 350
QAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAF    351 - 420
FAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ      421 - 488
//

Text Mined References (56)

PMID Year Title