Property Summary

NCBI Gene PubMed Count 119
PubMed Score 544.08
PubTator Score 392.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
pituitary cancer 1972 1.1e-02
subependymal giant cell astrocytoma 2287 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 3.0
Disease Target Count
Megaloblastic anemia 18
Nephroblastoma 51

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer 1.300 1.1e-02
subependymal giant cell astrocytoma 1.370 3.4e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (102)

AA Sequence

MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKED      1 - 70
LYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVRGHKGDRLVSQLKWFLEDEKR     71 - 140
AIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSN    141 - 210
FNPGRRQRITMAIRTVREEILKAQTPEGHFGNVYSTPLALQFLMTSPMRGAELGTACLKARVALLASLQD    211 - 280
GAFQNALMISQLLPVLNHKTYIDLIFPDCLAPRVMLEPAAETIPQTQEIISVTLQVLSLLPPYRQSISVL    281 - 350
AGSTVEDVLKKAHELGGFTYETQASLSGPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADYRPKDGETI    351 - 420
ELRLVSW                                                                   421 - 427
//

Text Mined References (119)

PMID Year Title