Property Summary

NCBI Gene PubMed Count 104
Grant Count 34
R01 Count 15
Funding $8,531,928.2
PubMed Score 494.16
PubTator Score 392.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
subependymal giant cell astrocytoma 1.370 0.034
pituitary cancer 1.300 0.011

 GWAS Trait (1)

Gene RIF (88)

PMID Text
26540672 In Asian populations, the investigated polymorphisms mapping at TCN2 and CBS genes did not provide any evidence of association with cleft lip/cleftpalate.
25395544 TCN2 776C --> G polymorphism is negatively associated with Alzheimer's type dementia, suggesting a protective role against the disease in subjects with the 5, 10-methylenetetrahydrofolate reductase 1298AA genotype
24750446 Transcobalamin II (TCN2 67A>G and TCN2 776C>G) and transcobalamin II receptor (TCblR 1104C>T) polymorphisms in Korean patients with idiopathic recurrent spontaneous abortion
24668664 neither MTHFD G1958A nor TC C776G polymorphisms are an independent risk factor for Down syndrome. However, the combined MTHFD/MTHFR, TC/MTHFR genotypes play a role in the risk of bearing a Down syndrome child in the Chinese population.
24122983 Proliferating cancer cells express measurable levels of TCII and TCII-R.
23099805 observation suggests that the missense variant Tc2. 776C>G influences both neurotoxicity and efficacy of methotrexate in patients with primary central nervous system lymphoma
23089108 haplotype association analysis revealed a significant association between idiopathic pulmonary fibrosis and transcobalamin II gene polymorphisms
22794911 preliminary results indicate that transcobalamin 2 gene polymorphisms can be a susceptibility factor for colorectal cancer
22188304 Three SNPs in transcobalamin II gene (G1196A, C776G and C1043T) are significantly associated with coronary artery disease in Indian population.
21975197 Variation in the TCN2 gene also affects recurrent stroke risk in response to cofactor therapy
More...

AA Sequence

MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKED      1 - 70
LYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVRGHKGDRLVSQLKWFLEDEKR     71 - 140
AIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSN    141 - 210
FNPGRRQRITMAIRTVREEILKAQTPEGHFGNVYSTPLALQFLMTSPMRGAELGTACLKARVALLASLQD    211 - 280
GAFQNALMISQLLPVLNHKTYIDLIFPDCLAPRVMLEPAAETIPQTQEIISVTLQVLSLLPPYRQSISVL    281 - 350
AGSTVEDVLKKAHELGGFTYETQASLSGPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADYRPKDGETI    351 - 420
ELRLVSW                                                                   421 - 427
//

Text Mined References (104)

PMID Year Title
26540672 2016 Non-syndromic cleft lip with or without cleft palate in Asian populations: Association analysis on three gene polymorphisms of the folate pathway.
25395544 2015 Association of the transcobalamin II gene 776C ? G polymorphism with Alzheimer's type dementia: dependence on the 5, 10-methylenetetrahydrofolate reductase 1298A ? C polymorphism genotype.
24750446 2014 Transcobalamin II (TCN2 67A>G and TCN2 776C>G) and transcobalamin II receptor (TCblR 1104C>T) polymorphisms in Korean patients with idiopathic recurrent spontaneous abortion.
24668664 2014 Combined folate gene MTHFD and TC polymorphisms as maternal risk factors for Down syndrome in China.
24122983 2013 Immunohistochemical quantification of the vitamin B12 transport protein (TCII), cell surface receptor (TCII-R) and Ki-67 in human tumor xenografts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23099805 2012 Association of transcobalamin c. 776C>G with overall survival in patients with primary central nervous system lymphoma.
23089108 2013 Idiopathic pulmonary fibrosis and polymorphisms of the folate pathway genes.
22794911 2013 A candidate gene study of one-carbon metabolism pathway genes and colorectal cancer risk.
22544364 2012 A genome-wide association study identifies susceptibility loci for Wilms tumor.
More...