Property Summary

NCBI Gene PubMed Count 48
PubMed Score 221.12
PubTator Score 312.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 4.021 1.2e-03
active ulcerative colitis 5.495 4.5e-03
Atopic dermatitis 1.800 1.6e-02
Breast cancer -3.900 2.0e-09
chronic rhinosinusitis 3.240 3.1e-03
cystic fibrosis 1.100 4.0e-02
interstitial cystitis 3.300 6.3e-03
lung adenocarcinoma 2.200 8.3e-04
medulloblastoma, large-cell 1.300 1.6e-03
mucosa-associated lymphoid tissue lympho... 3.534 3.6e-02
non-small cell lung cancer 1.311 5.0e-05
osteosarcoma -5.348 2.9e-08
pancreatic cancer 2.700 2.9e-04
primary pancreatic ductal adenocarcinoma 2.161 1.3e-03
psoriasis 5.700 3.4e-16

Gene RIF (32)

AA Sequence

MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQT      1 - 70
LMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTP     71 - 140
LTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKAD    141 - 210
EGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA    211 - 280
FSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV    281 - 350
TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV    351 - 420
RNGENLEVRWSKY                                                             421 - 433
//

Text Mined References (50)

PMID Year Title