Property Summary

NCBI Gene PubMed Count 46
Grant Count 52
R01 Count 26
Funding $5,237,685.22
PubMed Score 207.96
PubTator Score 312.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
24057896 Levels of holotranscobalamin are decreased patients with cobalamin deficiency.
23846701 Structural basis for universal corrinoid recognition by the cobalamin transport protein haptocorrin.
23670528 TCN1 gene expression implicates disease progression in patient with middle ear cholesteatoma.
22872637 comparison of human and rainbow trout cobalamin-binding protein
22306884 Elevated concentrations of B(12) found in autoimmune lymphoproliferative syndrome patients were due to increased lymphocyte expression of haptocorrin.
21574054 Stromal expression of KRT15, TCN1, and HOXB13 was significantly correlated with tumor grade, stromal hypercellularity, mitotic activity and microscopic borders.
20852008 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20216556 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20082058 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQT      1 - 70
LMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTP     71 - 140
LTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKAD    141 - 210
EGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA    211 - 280
FSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV    281 - 350
TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV    351 - 420
RNGENLEVRWSKY                                                             421 - 433
//

Text Mined References (48)

PMID Year Title
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24587374 2014 Transcriptomic profile reveals gender-specific molecular mechanisms driving multiple sclerosis progression.
24057896 2014 Role of serum holotranscobalamin (holoTC) in the diagnosis of patients with low serum cobalamin. Comparison with methylmalonic acid and homocysteine.
23846701 2013 Structural basis for universal corrinoid recognition by the cobalamin transport protein haptocorrin.
23670528 2013 Differential gene expression in cholesteatoma by DNA chip analysis.
22872637 2012 A single rainbow trout cobalamin-binding protein stands in for three human binders.
22306884 2012 Elevated vitamin B?? levels in autoimmune lymphoproliferative syndrome attributable to elevated haptocorrin in lymphocytes.
21574054 2012 Keratin 15, transcobalamin I and homeobox gene Hox-B13 expression in breast phyllodes tumors: novel markers in biological classification.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...