Property Summary

NCBI Gene PubMed Count 35
PubMed Score 50.27
PubTator Score 265.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
malignant mesothelioma 3232 2.5e-06
Disease Target Count Z-score Confidence
Skin cancer 469 0.0 3.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 23 3.306 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 2.5e-06

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (7)

AA Sequence

MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDL      1 - 70
DDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEIL     71 - 140
EKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV    141 - 210
RVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVT    211 - 280
CHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN                     281 - 333
//

Text Mined References (47)

PMID Year Title