Property Summary

NCBI Gene PubMed Count 33
Grant Count 15
R01 Count 12
Funding $1,391,979.13
PubMed Score 48.68
PubTator Score 265.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 0.000

Gene RIF (6)

PMID Text
22813744 This study provides mechanistic insight into the role of eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and eIF2beta
22174317 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 2 subunit 2 (EIF2S2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with EIF2S2 is increased by RRE
18639529 These findings suggest that alpha and beta subunits of eIF2 interact with each other and the beta-subunit plays a critical role both in the regulation and function of eIF2.
10648795 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 2 subunit 2 (EIF2S2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with EIF2S2 is increased by RRE
10620360 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 2 subunit 2 (EIF2S2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with EIF2S2 is increased by RRE
9079663 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 2 subunit 2 (EIF2S2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with EIF2S2 is increased by RRE

AA Sequence

MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDL      1 - 70
DDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEIL     71 - 140
EKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV    141 - 210
RVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVT    211 - 280
CHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN                     281 - 333
//

Text Mined References (44)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063529 2012 eIF2? mutation that disrupts eIF2 complex integrity links intellectual disability to impaired translation initiation.
22976474 2012 A meta-analysis of genome-wide association studies of breast cancer identifies two novel susceptibility loci at 6q14 and 20q11.
22813744 2012 The C-terminal domain of eukaryotic initiation factor 5 promotes start codon recognition by its dynamic interplay with eIF1 and eIF2?.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...